KEGG   Phaseolus vulgaris (common bean): PHAVU_006G094700gHelp
Entry
PHAVU_006G094700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00270  Cysteine and methionine metabolism
pvu00480  Glutathione metabolism
pvu01100  Metabolic pathways
Module
pvu_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PHAVU_006G094700g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHAVU_006G094700g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvu04147]
    PHAVU_006G094700g
Enzymes [BR:pvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PHAVU_006G094700g
Exosome [BR:pvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHAVU_006G094700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 18628290
NCBI-ProteinID: XP_007147080
UniProt: V7BM49
Position
6
AA seq 488 aa AA seqDB search
MCLFDYHRFDQELLRTIAYDALVWSSLHGLVVGDYSSQGSGSVPGVGLVHAPFALLPTPF
PQNQWRQASELAPIFNELVDRVSLDAPFLQHALSRTKEADEFTSRLLDIHCKMLQINKKE
EIRLGLHRSDYMLDEKTNSLLQIELNTIASSFAGLSNLVTELHRYILSRHGKVLGLDSKS
IGANDAVNQNAEALAKAWSEYNNPRAVIMIVVQAEERNMYDQHFVSAVLREKYPFLNRML
LYLYNTHNITSIRKTLAEVDEEGEILPDGTLCVDGREISVIYFRAGYTPVDYPSESEWKA
RLLMEQSSAVKCPSISYHLVGTKKIQQELAKPGVLERFLENKNDIVKLRKCFAGLWSLDD
SSILTKAIEKPELFVMKPQREGGGNNIYGDDVRETLQKLQKSGSQEDAAYILMQRIFPTI
SAAVLMRNGCLSKDHAISELGIFGTYLRNKDKVIINKPSGYLMRTKMSSSDEGGVASGFA
VLDSLYLT
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctcttcgactaccaccgtttcgatcaagaactccttcgcaccatcgcttacgac
gctctcgtttggagctctctccacggcctcgtcgttggtgattactcctctcagggatca
gggagcgttcctggcgtgggattggtgcatgctccgtttgcattgttgccgacgccgttt
ccccaaaaccagtggagacaagcctctgaattggctcctatattcaatgaactcgttgat
cgtgttagcttggatgcaccctttctccaacacgctctctccagaactaaggaagcggat
gaattcacctctagactcttggacattcattgcaagatgctacagattaacaaaaaagag
gaaatacgattggggttacatcggtcagattatatgcttgatgaaaagactaattcactt
ctgcaaatagaactgaacaccattgcctcttcatttgccggccttagtaaccttgtgact
gaacttcacagatacatactttctcgccatggaaaagtgcttggacttgattccaaaagt
attggtgccaacgatgctgttaatcaaaatgcagaggccctggctaaagcttggagtgag
tataataaccccagggctgtgattatgattgttgttcaagccgaagaacgaaacatgtac
gatcagcattttgtcagtgcagttctgagagaaaaatatccttttctgaatagaatgctt
ttatatctttataacacgcacaatattacaagtatacggaaaacattggcagaagtagat
gaagaaggggaaattttacctgatggaacgctttgtgtggatggacgggaaatttcagtc
atttatttccgtgctggctatacgccagttgactatccttcagaatctgaatggaaagct
aggctactgatggaacaatcttctgctgtcaagtgtccttctatttcctatcatctggtt
ggcacaaaaaagattcaacaggaacttgcaaagcccggtgttcttgagaggtttcttgaa
aacaaaaatgacattgttaaactgcgtaaatgctttgctgggttgtggagtttggatgat
tcaagtattcttacaaaagcaattgaaaagccagagttatttgtgatgaagccccaaaga
gaaggaggaggaaacaatatttatggtgatgatgtgagggagaccctccaaaagttgcag
aaatcaggttctcaagaagatgcagcttatatccttatgcagaggatatttccaactatt
tctgcagcagttttgatgcgtaatggatgtttgagtaaggatcatgccatttcagaacta
gggatatttggtacttatttaaggaataaggataaggttatcattaacaaaccaagtggc
tatttgatgcgtacaaaaatgtcatcatctgatgaaggtggggttgcatctggttttgca
gtgctagatagtctatacttgacttga

DBGET integrated database retrieval system