KEGG   Phaseolus vulgaris (common bean): PHAVU_006G177600gHelp
Entry
PHAVU_006G177600g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00010  Glycolysis / Gluconeogenesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_006G177600g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     PHAVU_006G177600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C NIBRIN_BRCT_II
Motif
Other DBs
NCBI-GeneID: 18629144
NCBI-ProteinID: XP_007148065
UniProt: V7BQ03
Position
6
AA seq 584 aa AA seqDB search
MESATKVGAAAQPTTAPPSFDGTLGCHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPR
LNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICVVGGP
NSNDYGTNRILHHTIGLPDFSQELRCFQSVTCFQAVVNNLEDAHELIDTAISTALKESKP
VYISISCNLPAIPHPTFARDPVPFYLAPKASNEEGLEAAVEATAALLNKAVKPVIVGGPK
LRVAKAQKAFLEFAEASGYPIAVMPSGKGLVPEYHPHFIGTYWGAVSTSYCGEIVESADA
YIFVGPVFNDYSSVGYSLLIKKEKAIIVQPNRVTIGNGPSFGWVFMADFLTALAKKVKTN
TTAVENYRRIYVPPGIPLKREKDEPLRVNVLFKHIQDMLGGDTAVIAETGDSWFNCQKLR
LPENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQK
SIIFLINNGGYTIEVEIHDGPYNVIKNWDYTRFVEAIHNGQGKCWVAKVRTEDDLSEAIR
TASGAEKDSLCFIEVFVHKDDTSKELLEWGSRVAAANSRPPNPQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgccactaaagtcggagcggcggctcaacccaccacggctcccccctccttc
gacggcacgctcggctgccacttggctcgccgcctcgtcgagataggcgtcagggacgtc
ttctccgtccccggcgacttcaacttgacgctgctcgaccacctcatcgccgagcccaga
ctcaacctcgtcggctgctgcaacgagctcaatgccggctatgccgccgacggctacgcg
cgtgccaggggcgtcggcgcttgcgtcgtcaccttcaccgtcggcggactcagcgtcctc
aacgccatagccggagcttacagcgagaatttaccggtgatttgcgtcgtcggaggaccg
aattcgaacgactacggcaccaaccggatcctccaccacaccatcgggttacccgatttc
tcccaagagcttcggtgctttcaaagcgtgacgtgttttcaggcagtggtgaataacttg
gaggacgcgcatgaactaattgacactgcgatttctactgctttgaaggaaagcaagcct
gtttatatcagcatcagttgtaatcttcctgcaattcctcatccaacttttgctagagac
cccgttccattctatcttgcacccaaggcaagcaatgaagaaggattagaagcagcagtg
gaagcaactgctgctttacttaacaaagctgtgaagccagtgattgtgggtggaccaaaa
ctaagggttgcgaaggcacaaaaggccttcctggagtttgcagaagctagtggatatcca
atagctgttatgccctcggggaagggacttgtaccagagtatcatcctcatttcattggt
acatattggggtgctgtcagtactagctactgtggagagatagtggagtctgctgatgct
tatatttttgttggccccgtcttcaatgactatagctccgttggatactcattgttgata
aagaaggagaaagccataatagtgcagcctaatcgggtgaccataggcaatggtccttca
tttggctgggttttcatggctgatttcttaactgcattggctaaaaaagtgaaaacaaac
accacggctgtggagaattaccgacgtatctatgtccctccaggcattcctttgaagcga
gagaaggatgaacctctaagagttaatgttctattcaaacacattcaagacatgctgggc
ggagatactgctgtaatagctgaaactggagactcgtggttcaactgtcagaagctccgt
ctgcctgagaattgcgggtatgaattccagatgcagtatggatccattggttggtcagtt
ggtgctactcttggatatgcacaagctgcaacagacaagcgtgtaattgcttgcattggc
gatggcagttttcaggtaacagcacaggatatttcaacaatgattcgatgcggacaaaag
agcatcatctttctcattaataatggaggttatacaattgaagttgagattcatgatggc
ccatacaatgtgatcaagaattgggactacacacgttttgtggaagccatccataatgga
caaggcaaatgctgggttgccaaggtacgaacagaggatgatttgagtgaagcaattaga
acagctagtggagcagagaaagattcactatgttttatagaagtttttgtacacaaggat
gacaccagcaaagaattgctggaatggggatctcgtgttgcagctgctaacagccgtcct
ccaaatccccaatag

DBGET integrated database retrieval system