KEGG   Phaseolus vulgaris (common bean): PHAVU_006G197000gHelp
Entry
PHAVU_006G197000g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
Organism
pvu  Phaseolus vulgaris (common bean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRRNT_2 LRR_1
Motif
Other DBs
NCBI-GeneID: 18629343
NCBI-ProteinID: XP_007148302
UniProt: V7BUP5
Position
6
AA seq 594 aa AA seqDB search
MTGFGAESDIYCLQTIKNMDPSNNILSSWDFQTNTEDVICTFSGVKCISNHVEDRVIGLW
LSNMGLKGQFPSCIEDFTWLQTLNLSNNELSGYIPNDISSKLSYLETLDLSNNYFSGEIP
KCIANLSGLITLLLDGNQLTGQIPQDLGLLPWLRDFSVANNFLEGSVPVFGSNLNVSLSY
VNNSGLCGGTLGRCDESLFGRSFWYSFIIGFVSSATSVLVSCMYYYAPWTEFKKRRSNAI
HPLIKKQNTEQEAELLPLAFQEQRSKELSILLERLITRMSFKELCKATDYFCTDNVLGIG
TTGIMYKAKVSNNCFLAVKRLYDADKYKWEFLLEIIIPGRHRHRNIVPLHGFCIEKEERV
LVYKYISNGRLSDWLQSEEEHHPIKLEWPERIHIALGLARGLSWLHKRCKIVHLNLDSDC
VLLDESFEPKISNFGKAKFLHQSVEDHVRMKMFLVDGVGVKGYAERDVYDFGIILFELIT
GKRLGQSVDSSDSISGHLMKYISKNLFTDPADFYDAIDDGIIGKGFDDKIVRLLEVACDC
VKTSLNQRQKMVDVHQTIRGMWEGYKPCFDSESLKQSMDCADHITCISEIECIE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgacgggttttggtgctgaaagtgacatctattgcttgcaaaccatcaagaacatggac
ccgtctaataatatcttatctagctgggatttccagaccaacactgaggatgtcatatgt
acattcagcggtgttaaatgcatcagcaatcatgtggaagatagagtaatcggtctctgg
ctatctaacatggggctgaagggtcagtttcctagttgcattgaagatttcacatggttg
cagactctgaacctctcaaacaacgagctttctggatatatcccaaacgatatatcatct
aagctgtcatatctggagacacttgatctctcaaataattatttctctggtgaaattcca
aagtgtattgccaatttgtcaggcttaattacccttctacttgatggcaaccagttaacg
ggccaaatcccacaagatcttgggttgcttccctggctgagagattttagtgttgctaac
aatttcttggaagggtcagtgcctgtttttgggagcaatcttaatgtgagtttgagctat
gtcaataatagtggactctgtgggggaacactaggaagatgtgacgagagcttgtttgga
agatcgttttggtatagttttattattggttttgtttcctcagctacttctgttctagta
tcttgcatgtactattatgcaccttggacagaattcaaaaagaggaggagtaacgctatt
catcccctaatcaagaagcagaacactgaacaagaagctgaattgctaccactggccttt
caagagcaacgaagcaaagagctatcaatattgttggagagattgattactagaatgagc
ttcaaggaattatgcaaggcaactgattacttttgcacagataacgtgttggggatagga
acgacagggattatgtacaaggcaaaggtatcaaataactgttttctggcagttaaaaga
ctatatgatgctgataagtacaagtgggaatttttacttgaaataatcatcccgggaaga
cacaggcacagaaacatagttccactgcatggattctgcatagagaaagaggaaagggtt
ttggtgtataagtacatttctaatggaagactcagtgattggttacaatctgaagaggaa
catcatccaataaaattagaatggcctgagaggattcacattgcacttgggctcgcaaga
ggtttatcttggctccataaaaggtgcaagatagtgcacctcaatttagattcggattgt
gtcttgctggacgagagttttgagccaaaaatttccaattttggcaaggcaaaattccta
caccagagtgttgaagatcatgtgaggatgaaaatgtttctggttgatggagttggagtg
aagggttatgctgagagggatgtctatgattttggaataatcctttttgaacttataacg
gggaaaagactaggccaatcggttgattcttcggacagtattagtgggcatttgatgaag
tatatcagcaagaacttgttcactgatcctgctgacttttatgacgccattgacgatggt
atcattgggaagggttttgatgataaaatcgtacgtcttcttgaagttgcatgtgactgt
gttaagacatctttaaatcaaaggcaaaagatggttgatgtgcatcaaactataagaggt
atgtgggagggctacaaaccctgctttgattctgaaagtctgaaacagtctatggattgt
gctgaccatataacgtgtatcagcgaaattgaatgtatcgaatag

DBGET integrated database retrieval system