KEGG   Phaseolus vulgaris (common bean): PHAVU_006G220500gHelp
Entry
PHAVU_006G220500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvu01001]
    PHAVU_006G220500g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     PHAVU_006G220500g
    2.7.11.23  [RNA-polymerase]-subunit kinase
     PHAVU_006G220500g
Protein kinases [BR:pvu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   PHAVU_006G220500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH RIO1 Seadorna_VP7 FTA2
Motif
Other DBs
NCBI-GeneID: 18629580
NCBI-ProteinID: XP_007148580
UniProt: V7BRG5
Position
6
AA seq 581 aa AA seqDB search
MGCICSKAHSSDQFVSQNHSQDLKVTSSSNTNHFGDTTSLISNANHHSNSNSNSSEEKAS
TPILSDQLQHKGEQNGNGNGVRSTKHTQQQQQPKMCRLYSITRGERGVQVLAGWPSWLSA
VAGEAISGWIPRRADSFEKLDKIGQGTYSSVYKARDLETNKIAALKKVRFTNMDPESVRF
MSREIIVLRRLDHPNVMKLEGMIASRVSGSLYLIFEYMDHDLAGLAAIPDNKFTEAQIKC
YMQQLLRGLEHCHSRGVVHRDLKGSNLLVDSNGKLKIGDFGLATLLQPSQGQPLTSRVVT
LWYRPPELLLGATDYGVTVDLWSAGCILAELFVGKPILSGRTEVEQLHKIFKLCGSPSEE
YWKKSKLPHSTIFKPQQPYKRIVSQTFKDFPSSTLSLMEVLLAVESNDRGTASSALRHEF
FTTMPLPCDPSSLPKYPPSKEFDAKLREEEARRRRAPNKGHEPESVGSNFRESKDVAIPD
ANADFQRQGRCISKRVTEKYNYEKDDGYGFSREPVKSRTLNVFPHSGQSMHPSVYGSSNN
MNLNEENVRTFHDHGSISGKSELRKHTSYWQVARRSIWHEI
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtatatgctccaaagcacattcatcagaccaattcgtttctcaaaaccattcc
caagatttgaaggtcacttcatcctccaacaccaaccatttcggagacaccacttccctc
atatccaatgcaaatcaccattcaaattcaaattcaaattcaagcgaagaaaaagcctcc
accccaattttgtcggatcagcttcaacataaaggggagcagaatggcaatgggaatggg
gtgcgatcaaccaaacatacacaacaacaacaacaacctaagatgtgtaggttgtatagt
ataaccaggggggaaagaggagttcaggttcttgctgggtggccctcttggctctctgct
gttgctggtgaagccattagtggctggatacctcgtagggctgattcctttgagaagttg
gataagattggccaaggaacttacagcagtgtttataaagctcgtgatctcgaaaccaat
aaaattgctgcattgaagaaggttcgatttactaatatggatccagaaagtgttcgtttt
atgtcaagggaaattattgtgctgcgaaggcttgatcatcccaatgtcatgaagcttgag
ggcatgattgcctcacgggtctctggtagcttgtaccttatctttgaatatatggaccat
gatcttgcaggacttgcagcaatacctgacaacaagtttaccgaagcacagatcaagtgt
tacatgcaacagcttcttcgtggtcttgagcattgtcacagtcgtggtgtcgtacatcgt
gacctaaaaggctcaaatcttctcgttgacagtaatggcaaactgaagattggtgatttt
gggctagcaactttgcttcagccatctcaggggcagcctttaacaagtcgggtagtaacc
ttgtggtacaggccacctgaacttcttcttggagctacagattatggagttactgtggat
ttgtggagtgctggatgtattcttgcagagttgtttgttgggaagcctatactgtctgga
cgaacagaggtggagcaactgcataaaatcttcaaactttgtggatctccctctgaagaa
tactggaagaagtcaaagctaccacattcaacaatttttaaacctcaacaaccttacaaa
cgcattgtttctcaaacattcaaggattttccttcatctaccctgagcctcatggaggtc
cttctagctgttgaatcgaatgatagaggaactgcatcttcagcacttcgacatgagttc
ttcacaacaatgccacttccttgtgatccatcatctttgccaaagtacccaccgagtaag
gagtttgatgcgaaacttcgcgaagaggaagctagaagacgaagagcaccaaataaagga
catgaacctgaatcagttgggagtaattttagagagtctaaagatgtggcaatacctgat
gcgaatgctgattttcagagacaaggacgctgtatttctaagcgcgtcactgagaagtac
aattacgaaaaggatgacggttatggcttctctcgtgaacctgtaaagtcaagaacactc
aatgtatttcctcattctggccagtcaatgcatccaagtgtttatgggtcctcaaacaat
atgaatttgaacgaggaaaatgttcgcaccttccatgatcatggctctatatcaggaaag
tctgagttgagaaaacatacttcctattggcaagttgccagaagatcaatttggcatgag
atataa

DBGET integrated database retrieval system