KEGG   Phaseolus vulgaris (common bean): PHAVU_007G105800gHelp
Entry
PHAVU_007G105800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00562  Inositol phosphate metabolism
pvu01100  Metabolic pathways
pvu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PHAVU_007G105800g
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    PHAVU_007G105800g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvu01009]
    PHAVU_007G105800g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     PHAVU_007G105800g
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     PHAVU_007G105800g
Protein phosphatases and associated proteins [BR:pvu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    PHAVU_007G105800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related BBL5 GRAM Y_phosphatase HR1 bPH_3 Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 18625490
NCBI-ProteinID: XP_007143837
UniProt: V7BH90
Position
7
AA seq 847 aa AA seqDB search
MDVPKHRATRTTSLRDASDSSKMEGTGSWDAIEWTKIEPIARFVSHANLDFLIEAEQVVA
EGHGVVLVNTDDAGTLMVTNFRLIFLSEGTRKVISLGTIPLATIEKFNKMVVKVQSNSRH
VDKTPAQRLLQVIGKDMRIIVFSFRPRTKQRRVVFDALLRCTKPARLWDLYAFASGPSRF
NNTTPLVRLLDEYSRLLCLGSFCASIDIIENGSYTLSNDLWRISSVNSNYTMCQSYPFAF
IVPKIISDDEVLQACSFRARCRLPVVSWCHPLTGAVVARSSQPLVGLMMNMRSNMDEKLV
AALCSKLDNGSRRKLYIVDARPRKNALANGAMGGGSESSSNYFQSEVVFLGIDNIHAMRD
SFVRLREYMDTHGRTSSDGMSSFLRQGGSTWGGGNLSSMSASVSTLGDSGWLLHVQNVLA
GAAWIAARVAMENASVLVHCSDGWDRTSQLVSLANLLLDPYYRTFTGFQALIEKDWLAFG
HPFSDRVGMPSVSGTGNMAFELSRQPSTGNFSSSPGRQSSGTFSSQPPASSHSHNSNNYS
PIFLQWVDCVSQLLRMYPFAFQFSAAFLVDFIDCMLSCRFGNFLCNSEKERQQCNVFEAC
GCLWVYLADLRTSEGGSHVHYNPFYDPLKHNGPLLPPAAALAPTLWPQFHLRWACPEEAQ
AGEIEAQCRKILIKCSEMQKGKEMAERKAKEVTNSMESLNAELRREKQLNNSAMNMAKTT
SKENMAIKRAIQSMGCKVHVSGSGECTVDIESNPDILCCSSRKESNSTVRDDKTDLPVSV
LVTADDVDGNSGIVRVCETLCPFGSGGGGCRWPNGGCAQQGSQYVGLKANFDAFDQLSID
DSYFKSE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcccaagcaccgtgccactcgaacaacctctctccgggatgcctctgactcc
tccaagatggaaggcaccggaagctgggacgccatcgaatggaccaaaattgagccaatt
gcgcgcttcgtctcgcatgcgaatctcgatttcttgatcgaggcggagcaagttgtcgcc
gaaggacatggtgttgttcttgttaatacggatgatgctggcacattgatggtaacgaat
ttccgtcttatttttctgagtgagggcactagaaaagttatttcccttggaacgatacca
ctagcaaccattgagaagtttaacaagatggttgtaaaggttcagtcaaatagtcgtcat
gtagacaagacaccagcacagagactgcttcaggtgattggaaaagatatgagaattata
gtcttcagtttcagaccacgtacaaaacagagacgtgtggtatttgatgcgctattgagg
tgtacaaagcccgcaagattatgggatctttatgcttttgcatcaggaccttctaggttt
aacaacactactccactggtccgtttactggatgaatattctcggcttctttgcctaggt
tctttttgtgcatcaatcgatataattgaaaatgggtcatacacgttgtcaaatgaccta
tggagaataagtagtgtgaattccaattatacaatgtgccagagttatccatttgctttc
attgttccaaagatcattagtgatgatgaagtactccaggcatgcagcttccgtgcaaga
tgtcgactacctgtagtttcatggtgccatcctttgactggagcagttgttgcacgatct
tctcaacccttagttggtcttatgatgaacatgaggagcaacatggatgaaaaacttgtg
gctgcactctgtagcaaactagataatggctcaagaagaaagttgtatattgttgatgca
cggccaagaaaaaacgcattggctaatggagccatgggaggtggttcagagtcatcatca
aactattttcaatctgaggtagtctttttggggatagacaacatccatgcgatgagagac
agctttgttcgtctccgagaatacatggacactcatggcagaacatcatcagatggaatg
tcctcttttttgagacaaggtgggtcaacatggggtggtggcaatctaagtagtatgtct
gcttcggtatcaacccttggggacagtggatggttactgcatgttcagaatgtgttggct
ggagcagcttggattgctgctcgtgttgcaatggaaaacgcttctgtccttgtgcattgc
agtgatggatgggataggacaagccagttggtttcacttgctaatttgttgcttgatcca
tattatcggacattcacagggtttcaggcactcattgaaaaagactggcttgcttttggt
catccattttctgatcgggtgggaatgccatctgtctctggaactggcaacatggctttt
gagttatctaggcagccttcaaccggaaatttctcatcttcacccgggcgccagtcatca
ggaacattctcatcacaacctccagcttcatctcactcacataactccaacaactattct
cctatttttttgcagtgggttgactgtgtttcacaattattgcggatgtatccttttgct
tttcagttctctgcggccttcctggtggacttcatagactgcatgctttcttgtcgtttt
gggaacttcttatgtaacagtgagaaggagaggcagcaatgcaatgtttttgaggcatgt
ggatgtctgtgggtatatttagctgatttgcggacatcagaaggaggttcccatgtgcat
tacaatcccttctatgatccactcaagcataatggtcctcttctgcccccagcagcagca
ttggcccctacattgtggccccaattccaccttcgttgggcatgcccagaagaagcacaa
gctggggagattgaagcacaatgcaggaagatacttataaaatgctctgagatgcagaag
ggtaaagaaatggcagaaagaaaagctaaagaagttacaaattccatggagtcattgaat
gcagaattacgacgggagaagcagctaaacaactcagctatgaacatggcaaagactacg
agcaaagaaaatatggccataaagcgtgctattcagtcaatggggtgcaaggttcatgtc
tctggtagtggtgaatgcactgttgacattgaaagcaacccagacattctgtgctgttcc
tctagaaaagaatcaaatagtactgtgcgtgatgacaaaacggatctgcctgtttcagta
ctagttacagcagatgatgttgatggaaacagtgggattgttcgggtatgtgaaactctg
tgcccatttggctctggaggtggaggctgcaggtggccaaatggtggttgtgctcaacaa
ggtagccaatatgttggcctgaaggcaaacttcgatgcatttgaccaattgtcaattgat
gatagttatttcaagtctgagtga

DBGET integrated database retrieval system