KEGG   Phaseolus vulgaris (common bean): PHAVU_007G122200gHelp
Entry
PHAVU_007G122200g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00260  Glycine, serine and threonine metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHAVU_007G122200g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PHAVU_007G122200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_3 Pyridoxal_deC Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 18625657
NCBI-ProteinID: XP_007144017
UniProt: V7BDV5
Position
7
AA seq 365 aa AA seqDB search
MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFRLEAEMAKTMGKEAALFVP
SGTMGNLICVLVHCDVRGSEVILGDNCHIYIYENGGIATIGGVHPRPVKNNDDGTMDIDL
IETAIRDPRGELLYPTTKLICLENTHANSGGRCLSVEYTDRVGELAKKHGLKLHIDGARI
FNASVALGIPVDRLVQAADSVSVCLSKGIGAPVGSVIVGSENFIAKARRLRKTLGGGMRQ
IGILCAAALVALQENIGKLENDHKKARLLADGLRELKGLRVDTLGVETNIVFIDIEDGIQ
TRAEKICKYLEERGILLMQESSSRMRVVLHHQISASDVQYALSCFKAMLTTNQQVVKGVE
KEMDD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtaactagaattgtggatcttcggtcagacacagttacgaagccaactgaagcaatg
cgggctgccatggcgagtgctgaagttgatgacgatgttctaggcaatgaccctactgct
ttccgcttagaagcagagatggcaaagacaatgggcaaagaagctgctctttttgtccca
tctggcacaatggggaaccttatatgtgtacttgttcattgtgatgtcaggggaagtgaa
gttattcttggagacaattgccatatctatatttacgagaatggcggcattgcaactatt
ggcggggtgcatccaagaccagtgaagaataacgatgatggaaccatggacattgatttg
attgaaactgctatcagggaccctaggggggagttactgtatccaaccaccaagcttatt
tgcttggaaaatactcacgcaaactctggtggcagatgcctctcagttgaatatacagac
agagttggggagttagctaagaagcacggactgaagcttcacattgatggagcccgtatt
tttaacgcatcagttgcacttggtattccagtggataggcttgtccaagcagccgattca
gtttccgtttgcctatctaaaggtataggtgctccagttggatctgttattgttggttcc
gagaattttattgcaaaggccagacgactccggaaaaccttaggaggtggaatgagacag
attggcatcctttgtgctgcagcacttgttgccttgcaggaaaatattggaaagctggaa
aatgatcacaagaaagctagactgttagctgatggattgagggaacttaaaggactgaga
gtggatacccttggtgtggagaccaatatagtattcattgacattgaagatggtatccag
actagggcagagaaaatatgcaagtacttggaagaacgtggtatccttttgatgcaagag
agctcatcaagaatgagagttgttctccaccaccaaatatcggcaagcgatgtgcaatac
gccttgtcatgctttaaggcgatgttgactacaaatcagcaagttgttaagggagtagaa
aaagaaatggacgactag

DBGET integrated database retrieval system