KEGG   Phaseolus vulgaris (common bean): PHAVU_007G169600gHelp
Entry
PHAVU_007G169600g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00480  Glutathione metabolism
pvu00590  Arachidonic acid metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PHAVU_007G169600g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHAVU_007G169600g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PHAVU_007G169600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Xrn1_D3
Motif
Other DBs
NCBI-GeneID: 18626151
NCBI-ProteinID: XP_007144607
UniProt: V7BJ70
Position
7
AA seq 83 aa AA seqDB search
MESFPTIVLSFPKTKEKVRVNGSDSTPVYKYLKANKSGFVSSRIKWNFTKFLVDEEGHVI
NRYSPTTQPLAIENDIKKALRLD
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctttccaactatagtcctatctttccctaaaactaaagagaaggtgcgtgtg
aatggatcagatagtacaccagtgtacaaatacctgaaagcaaataaatctgggtttgtg
agttctagaatcaaatggaatttcactaagtttctagttgatgaagaaggccatgtcatt
aaccgttatagcccaaccactcagccattagccattgaaaatgacatcaagaaagccttg
cgtttggattga

DBGET integrated database retrieval system