KEGG   Phaseolus vulgaris (common bean): PHAVU_007G218800gHelp
Entry
PHAVU_007G218800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PHAVU_007G218800g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pvu03032]
    PHAVU_007G218800g
   03036 Chromosome and associated proteins [BR:pvu03036]
    PHAVU_007G218800g
   03400 DNA repair and recombination proteins [BR:pvu03400]
    PHAVU_007G218800g
Enzymes [BR:pvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     PHAVU_007G218800g
DNA replication proteins [BR:pvu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     PHAVU_007G218800g
Chromosome and associated proteins [BR:pvu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    PHAVU_007G218800g
DNA repair and recombination proteins [BR:pvu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     PHAVU_007G218800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR SAP Enkurin
Motif
Other DBs
NCBI-GeneID: 18626656
NCBI-ProteinID: XP_007145201
UniProt: V7BJI7
Position
7
AA seq 589 aa AA seqDB search
MASSKMRVEELRTELHNRGLSITGTKPTLLRRLGAALRKETRNATSEADASSTRRTRKRA
RDSHNQDCDHSQEIEVAEETKEEEVKIVTATKKGVAVLDQYLPDSVKTNYHVLRLGGDVY
DAMLNQTNVTDNNNKFYLIQVLESDTGGEFLVYNRWGRVGVKGQDKILGPYKSCESAIQE
FEQKFLAKTKNAWSDRDSFVSYPKSYAWLEMDYSGKENESTVTENHGRALGKQPQESKLE
PRVAKFISLICNVSMMNQQMMEIGYNANKLPLGKLSKSTILKGYEVLKRLANVIDKGDRK
VMEQLSGEFYTVIPHDFGFKKMSVFVIDTPQKLKRKLEMVEALSEIEVATKLLKDDAEMQ
GDPLYTRYQRLHCELVPVEFGCGEFSMIEEYMKSTHAETHSNYTVEIVQIFRTSREGESE
QYRKFASTKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSAN
YCYASRTAKDGVLLLCEVALGEMAGLLNACYDADQLPEGKLSTKGLGATAPDPSKARELE
DGLVVPLGKPEKHLCLKSSLLYNEYVVYNVEQIRMRYIVHVNFNFKSKR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagtaaaatgagggtggaagagctaagaacggagctccacaaccgtggactc
tccatcaccggaacgaaacccactctgctacgtagacttggagccgctcttcgcaaagaa
actcgaaatgcgacgagtgaagctgatgctagttccactcgtagaactagaaagagagcg
agggattcgcacaatcaggattgtgatcactcccaagaaatcgaggttgcagaggagaca
aaagaggaggaggtgaagatagtgactgcaaccaaaaagggcgtggcggttctcgatcag
tatcttccggattctgtgaaaacgaattatcatgttctgcgtctgggtggtgacgtctat
gatgctatgttgaatcagacgaatgtcacagacaacaataacaagttctatttgattcaa
gttcttgaatcggatactggtggtgaattccttgtttacaatagatggggaagggtaggt
gtaaagggccaagacaagatacttggtccttacaaatcatgtgagagtgccattcaggaa
tttgaacaaaagtttttagccaagaccaagaatgcttggtccgatagggatagttttgtt
agctatcctaaaagttatgcgtggctggaaatggactacagtggcaaggaaaatgaatct
actgttacagaaaatcatggtcgtgctttaggaaagcagcctcaggaatctaaacttgaa
ccacgtgttgcaaaatttatatctcttatttgcaacgtgagcatgatgaatcagcaaatg
atggaaatagggtacaatgcaaacaagttgccccttggaaaacttagcaaatcaacaatt
ttaaagggctacgaggttctcaaaagacttgctaatgtgattgataaaggtgacaggaaa
gttatggagcaattaagtggagaattctacactgtaattccacatgattttggattcaaa
aaaatgtctgtgtttgtaattgacacccctcagaagttaaaacgcaagttagaaatggtt
gaagctcttagtgaaattgaggttgccacaaagcttttgaaagatgatgcagaaatgcag
ggagatcccctgtatacgcgttatcaacgccttcattgcgaactggtacctgttgaattt
ggttgtggggaattctccatgattgaagagtatatgaagagcactcatgcagaaactcat
tcaaactatactgtggaaattgttcaaatatttaggacatcacgagaaggcgagtctgaa
cagtacagaaagttcgctagtacaaaaaataggatgcttttgtggcacggttctcggctt
acaaactggactggaattttatctcaaggtttacgcatagcccctcctgaggcacctgta
actggctacatgtttggaaagggagtgtactttgctgacatgttctcaaaaagtgcaaat
tattgctatgctagtcgtactgctaaagatggagtgctccttttatgcgaggttgcactg
ggagagatggctgggcttctaaatgcctgctatgatgccgatcagttgcctgaaggaaaa
ctgagcacgaaaggattaggagctactgctcctgatccctcaaaagcacgggaacttgag
gatgggctcgtagttcccctaggaaagcctgaaaaacatttatgcctcaagagctctctg
ctgtacaatgaatacgttgtttataatgtggagcagattaggatgcgctatattgttcac
gtaaatttcaattttaagagtaaacgttag

DBGET integrated database retrieval system