KEGG   Phaseolus vulgaris (common bean): PHAVU_007G223700g
Entry
PHAVU_007G223700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00100  Steroid biosynthesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Module
pvu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PHAVU_007G223700g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PHAVU_007G223700g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18626705
NCBI-ProteinID: XP_007145258
UniProt: V7BHD4
Position
7
AA seq 373 aa
MESHVDLGFLLHALMPSWNSVPLLAGFFSYLAIAGSILPGKLVPGVALPDATRLHYRCNG
LLSLLLLVAFLGIGAKMGFVSPTAISDRGLELLSTTFLFSFLVTLVLYFFGCKSQSKGSS
LKPHISGNLIHDWWFGIQLNPHFMGIDLKFFFVRAGMMGWLLINLSILMKSIQDGTLSQS
MILYQLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNS
VELTTAAIVANCFVFLIGYMVFRGANKQKHVFKKNPKAPIWGKPPKVVGGKLLASGYWGV
ARHCNYLGDLMLALSFSLPCGISSPIPYFYPVYLLILLIWRESRDEARCAEKYREIWAEY
RKLVPWRILPYVY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggagtcgcacgtggatctgggttttctcctacacgctctcatgccatcttggaactcc
gttcctttgctcgcggggttcttcagttacttggccattgctggatccattctccctgga
aaacttgttcctggggttgctctaccggatgcaactcgtcttcactatcgctgcaacggt
ctgctctcgcttcttctgttggttgcttttcttgggatcggtgccaagatgggttttgtg
tctcccactgccatatcagacagaggacttgagctgctgtccacaacgtttctctttagt
tttcttgtgaccctggtactgtatttttttggttgcaagtcacaaagtaaaggctcatct
ctaaaacctcatatcagtgggaacctgatacatgattggtggtttggaatacaactaaat
cctcacttcatgggtattgacctcaaatttttctttgttagagctggaatgatggggtgg
ctacttatcaatttatctattcttatgaagagcattcaagatggtactttgagccagtca
atgattctctaccagctattctgtgcactatacatcctggactattttgtacatgaagaa
tacatgacatccacctgggacataattgcagagagattgggcttcatgttggtctttgga
gatttagtgtggatacctttcactttcagcatacaggggtggtggctattgaggaacagt
gtggagttaacaacggctgccatagtagctaattgctttgtcttcttgatcggatatatg
gtatttcgaggagcaaacaagcaaaaacacgtattcaaaaagaatccaaaggctcctatt
tggggtaagcctccaaaagttgttggaggcaagctactagcgtctggttattggggtgtt
gctaggcactgtaattacctaggagatttgatgcttgctctctcctttagtttaccttgt
gggataagttcaccaattccatacttctatcctgtttatcttcttattctgttgatctgg
agagagagtagggatgaagctcgttgtgcagagaaatatagagagatatgggcagagtat
cgtaaacttgttccatggagaatattgccttatgtttattag

DBGET integrated database retrieval system