KEGG   Phaseolus vulgaris (common bean): PHAVU_008G128700gHelp
Entry
PHAVU_008G128700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K15814  beta-amyrin 24-hydroxylase [EC:1.14.14.134]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00909  Sesquiterpenoid and triterpenoid biosynthesis
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    PHAVU_008G128700g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pvu00199]
    PHAVU_008G128700g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.134  beta-amyrin 24-hydroxylase
     PHAVU_008G128700g
Cytochrome P450 [BR:pvu00199]
 Cytochrome P450, plant type
  CYP93 family
   PHAVU_008G128700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 KIP1
Motif
Other DBs
NCBI-GeneID: 18622711
NCBI-ProteinID: XP_007140634
UniProt: V7B702
Position
8
AA seq 512 aa AA seqDB search
MLDIKGYLVLFFLWFISTVFIRSIFKRSQGMKLPPGPPISIPLLGNAPYLRAVLHQALYK
LSLRYGPLIHITIGSKNVVVASSPETAKQILKTSEEAFCNRPLMIASESLTYGAADYFFI
PYGTYWRFLKKLCMTELLSGRTLEHFVGIRESEVEAFLKRMLEISETGKEVVMRQELITH
TNNIITRMIMGKKSNDANDFVAQLRMLVREVAELLGAFNLGDIIGFARPLDLQGFGKKNM
ETHQKVDTMLEMVLKEHEKARAKAAADSDRKKDLFDILLNLIEADGTDNKLTRQSAKAFA
LDMFIAGTNGPASVLEWSLAELVRNPHVLKKAREEIDSVVGKERVVKESDIPNLPYLQAV
VKETLRMHPPTPIFAREAMRTCQVDGYDIPAHSTILISTWAIGRDPNYWDNALEYNPDRF
LVSDEVGKGKIDVRGQYYQLLPFGSGRRSCPGASLALLVMQATLASLIQCFDWVVNDGKS
HDIDMTEEGRVTVFLKKPLTCKPVPRFTPFAA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctagacatcaaaggttaccttgttctattcttcctgtggttcatttccacagttttt
attcgttcaatcttcaaaagatcccagggtatgaaactccctcctggtcctcccatctca
atacccttactagggaacgcaccgtatctccgtgcggtgcttcaccaagcactgtacaaa
ctctccctacgatatggtcccttgatccatatcaccatcggctccaaaaacgtcgttgta
gcttcctccccggagacagccaaacagatccttaaaacctccgaagaggccttctgcaac
cgccccttaatgattgcgagcgagagtttaacctacggcgccgctgactacttcttcatt
ccgtacgggacctactggcgcttcctgaagaagctctgcatgacggagcttctcagcggg
aggactctggagcattttgttggcattcgggagagcgaggtggaagcgtttttgaagcgg
atgttggagatttcggagacggggaaggaggtggtgatgaggcaagaactcataacgcac
accaataatattatcacgaggatgatcatggggaagaagagcaatgatgcgaatgatttt
gtggcgcagttgaggatgttggtgagggaggtagcggagttactgggggctttcaacttg
ggagacatcatagggtttgcgaggcctttagatctgcaggggtttgggaagaagaacatg
gaaacgcaccagaaggtggatacgatgttggagatggtgctgaaggagcacgaaaaggcg
agggccaaagcggctgctgacagtgatcggaagaaggatctcttcgacattctcttgaac
ctaattgaagctgatggtactgacaataaactcacaaggcaaagtgccaaagcctttgct
ctggacatgttcatcgcggggacaaatggccccgctagtgttctggaatggtcccttgcc
gagctggtgcggaacccgcatgtgttgaagaaggcgagagaggagatagactctgtggtg
ggaaaggagagggtggtgaaggagtcagacattcccaacctcccttatctgcaagcagtg
gtgaaggaaactctgagaatgcacccacccaccccaatattcgcgcgagaagccatgcgc
acgtgccaggtcgacggctacgacatccctgcgcactccaccattctcatcagcacgtgg
gccattggcagagaccccaactactgggacaacgccctggagtacaacccagataggttc
ttggtctccgatgaagttggaaaaggcaaaatcgatgtgaggggacagtattaccagctt
ctacccttcggaagcggaagaagaagctgccccggagcctcacttgcgttactcgtaatg
caagccacgctcgccagtttgatccagtgcttcgattgggtggtaaatgatgggaagagt
cacgacattgacatgacggaggagggaagagtcacggtgtttttgaagaagccgcttacc
tgcaagcctgttccgcggttcactccgttcgctgcatga

DBGET integrated database retrieval system