KEGG   Phaseolus vulgaris (common bean): PHAVU_008G260300gHelp
Entry
PHAVU_008G260300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PHAVU_008G260300g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     PHAVU_008G260300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 18624073
NCBI-ProteinID: XP_007142196
UniProt: V7B9G0
Position
8
AA seq 477 aa AA seqDB search
MSWFRHLSSKTRRFTSLSRFSTSTSPVHHAGLGPTKAHEKPRVVVLGSGWAGCRLMKGLD
PKIYDIVCVSPRNHMVFTPLLASTCVGTLEFRTVAEPIARIQPAISREPGSFFFLANCTS
IDAVNHVVQCESVTEGTKTLDPWKFAISYDKLVIALGAQPTTFGIHGVYEHAIFLREVYH
AQEIRRKLLLNLMMSDVPGIGEEEKRRLLHCVVVGGGPTGVEFSGELSDFIVRDVRERYS
HVKDYIHVTLIEANEILSSFDVRLRQYATNQLTKSGVRLVRGIVKDVEERKIILNDGTEV
PYGLLVWSTGVGPSAFIQSLDFPKSPGGRIGTDEWLRVPTVDDIFSIGDCSGFVESTGKQ
PLPALAQVAERQGKYLAILLNKIGKANGGRANSAKDLDFGEHFVYKHLGSMASIGSYKAL
VDLRQSKEDKGLSMAGFVSWFIWRSAYLTRVISWRNRFYVAINWATTFVFGRDISRI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggttccgacacctctcctccaaaacgcgccgtttcacttctctctcccggttc
agcacctccacaagcccggttcaccatgccggtctcgggcccaccaaggcccacgagaag
ccccgtgtggtcgtgctgggctctggctgggctggctgccgcctcatgaagggcctggat
cctaaaatctacgacatcgtttgcgtgtcaccgcgcaaccacatggtgttcacgcctctc
ttggcttccacgtgcgtcggaacgctcgagttcagaactgttgccgaacccatcgccagg
atccaacccgccatttcccgggaacctggctctttcttcttcctcgccaattgtacttcc
attgatgctgtcaaccatgtcgtgcaatgtgagtctgtaactgaaggaacgaagacacta
gatccctggaagtttgcaatctcatatgataagctggtaattgcattaggagcacaacct
accacttttggaattcatggagtctatgagcatgcaatttttcttcgtgaagtttaccat
gcacaggaaattcgtcggaagttgcttctgaacttaatgatgtctgatgttccagggatt
ggagaagaggaaaaaaggaggctgttacactgtgtggttgtgggaggcggtcccactgga
gttgaattcagcggtgaacttagtgattttatcgtaagagatgtccgtgagagatattct
catgtgaaggattacatccacgttactttaattgaggccaatgagatcctgtcttccttt
gatgtccgactcaggcaatatgccaccaatcaattgacaaagtcaggagtccgactagtc
cgtggcattgtgaaagatgtcgaggagaggaagattatcctaaatgacggaactgaggta
ccatatgggttgctcgtatggtcgactggagttggtccatcagcttttattcagtctttg
gatttccctaaatctcctggtggaaggattggcactgatgaatggcttcgtgttcctaca
gtagatgatatcttctcaataggtgactgcagtggatttgtagaaagtactggaaaacaa
ccactaccggctttagcccaagtggcagaaaggcaaggtaaatatttagcaatcttacta
aacaaaataggtaaagcaaatggaggccgtgcaaacagtgcaaaggacttagactttggg
gaacattttgtttacaagcaccttggaagcatggcatctatagggagttacaaggctcta
gtggacctcagacagagcaaggaggacaaagggttatctatggcaggttttgtcagttgg
tttatttggcgctcagcatacctaactcgtgttatcagctggaggaacagattctatgta
gccatcaactgggctactacttttgtgtttggccgagatataagcagaatatga

DBGET integrated database retrieval system