KEGG   Phaseolus vulgaris (common bean): PHAVU_008G286300gHelp
Entry
PHAVU_008G286300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvu01001]
    PHAVU_008G286300g
   01009 Protein phosphatases and associated proteins [BR:pvu01009]
    PHAVU_008G286300g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PHAVU_008G286300g
Protein kinases [BR:pvu01001]
 Serine/threonine kinases: Other
  Wnk family
   PHAVU_008G286300g
Protein phosphatases and associated proteins [BR:pvu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PHAVU_008G286300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 18624336
NCBI-ProteinID: XP_007142505
UniProt: V7B9I9
Position
8
AA seq 297 aa AA seqDB search
MPAEKSNSCDAEVEAFVEVDPTGRFGRYNDLLGCGAVKKVYRAFDQEEGIEVAWNQVRLR
NFSEDPVLINRLHSEVELLRTLSNKYIIVCYSVWKDEERHNINFITEICTSGNLRDYRRK
HRHVSIKAFKKWSKQVLEGLEYLHTHDPCIIHRDLNCSNIFVNGNIGQVKIGDLGLAAIV
GRNHAAHSILGTPEYMAPELYEEDYTEMVDIYSFGMCLLEMVTMEIPYSECDSVAKIYKK
VTKGIKPQALSKVTEPEVKEFIEKCIAQPRARPSATDLLKDPFFYELNDDEESTPIN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcggagaagtcgaacagttgcgacgccgaagtggaagcgttcgtggaggttgat
ccgacgggaaggtttgggcgttataacgatcttctcggctgtggagctgtgaagaaggtt
tacagagcttttgatcaggaggaaggaattgaggtggcgtggaatcaggttcggctcagg
aatttcagcgaagatcctgttctcatcaaccgtcttcattctgaggttgagttgctcaga
accctcagcaacaagtacatcatcgtctgttacagtgtttggaaggatgaggaacgccac
aacatcaatttcatcactgagatttgcacttccgggaacctcagggattaccgcaggaag
caccgccatgtctccattaaggcattcaagaagtggtccaaacaggtccttgaggggttg
gagtatcttcatactcatgacccatgcatcattcacagggatctcaactgcagcaacatc
tttgttaacggcaacattggccaggtgaaaattggtgatcttggattggctgcaatagtg
ggacggaaccatgctgcacattctattttggggacgcctgaatacatggcaccggagctg
tatgaggaagattacactgagatggtggacatatactcttttggaatgtgtttgcttgaa
atggttacaatggagataccctacagcgaatgtgacagtgtggccaagatatacaaaaag
gtgaccaagggaattaagcctcaggccttgagcaaagtgacagaacctgaggtgaaggaa
ttcattgagaagtgcatagcacagccaagggcaagaccttctgccacggatctccttaag
gatcctttcttttatgaactcaacgatgatgaagaatcaacgcccataaattga

DBGET integrated database retrieval system