KEGG   Phaseolus vulgaris (common bean): PHAVU_009G172500gHelp
Entry
PHAVU_009G172500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pvu03021]
    PHAVU_009G172500g
Transcription machinery [BR:pvu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     PHAVU_009G172500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 BRCA-2_helical baeRF_family3
Motif
Other DBs
NCBI-GeneID: 18620445
NCBI-ProteinID: XP_007137998
UniProt: V7AWG8
Position
9
AA seq 505 aa AA seqDB search
MGYEDNPYRDEDGEPLMDYDDVQSDREPSPEPRHQLDDYEDDVNDEWRGRDRSQTPVYDN
DAARSKPRKRLIKKSVAGKQSVAAELEDEEEEGYVPEARFDEEDGRKRKKGKEVGSGKKE
KRLKGEQRFGSGDGSKFGGSKKGFGGKAGKDHDGEVKEMWDTIAGGDSEDDHDGVRDLDD
DNFIDDTGVEPAYYGSDEPRSPGDAPQAEEGEEDSEMKDLFKIGKKRKKNERSPAEIALL
VENVMAELEVTAEEDADLNRQGKPAINKLKKLTLLTEVLSKKQLQLEFLDHGVLTLLKNW
LEPLPDGSLPNINIRMEILRILNEFPIDLEQYDRREQLKKSGLGKVIMFLSKSDEEISVN
RKLAKELVDKWSRPIFNKSTRFEDMRNVEDDRVTYRRPSVKKPTNKVAGISRDSDLDLEI
SQPTTAGQSSSRQHASRPEATPLDFVIRPQSKIDPDEIRARAKQAAQDQQRMKMNKKLQQ
LRAPKKRQLQATKLSVEGRGMVKYL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgaagacaatccgtatcgcgacgaggacggtgagcccttgatggactacgac
gacgttcaatccgaccgcgagccctccccggagccgcgtcaccagctcgacgattacgag
gacgatgtcaacgacgagtggcgcggccgggatcggtcgcagacgccggtgtacgacaac
gatgcagcgcgatcgaagccgcggaagaggctgatcaagaagagcgtcgctgggaagcag
tcggtggcggcggagctcgaggatgaggaggaggaggggtatgttccagaggcgaggttt
gacgaggaagatggaagaaagaggaagaagggaaaggaagttgggagtgggaagaaggag
aaaaggctgaagggggaacagaggttcggtagtggcgatggatccaaatttgggggttcg
aaaaaaggttttggtggtaaggctgggaaggatcatgatggtgaagttaaggagatgtgg
gatacaattgctgggggagattctgaggatgatcacgatggtgtcagggatctggatgat
gacaactttatagatgacactggagtggaacctgcttattatggtagtgatgaaccacgt
tctcctggtgatgctcctcaggcagaagaaggtgaagaggattcagaaatgaaggatctt
tttaaaatagggaagaaaaggaagaagaacgagagaagtcctgctgaaatagcattacta
gtggagaatgtcatggctgagcttgaggttacagctgaagaggatgctgatcttaataga
caggggaaacctgctattaataaactcaagaaactgactcttctcacagaagtcctctcg
aaaaaacaacttcaattagagtttttagatcatggagttctaacattattgaagaattgg
cttgagccacttcctgatggaagtttgcctaatataaatatacgcatggaaatattgagg
attttgaatgagtttcctatagacctagagcagtacgataggagagaacaactgaaaaag
agtggccttggaaaggtgattatgtttttatcaaaatctgacgaagaaatcagtgtaaat
agaaaactagccaaggagttggttgacaagtggagccggcctatatttaataagagtacc
cgatttgaagacatgagaaatgtagaagatgatagggttacttataggagaccatctgtt
aaaaagccaactaataaagttgcaggaatatcgagagatagtgatcttgatttggaaatt
tcacagcctactacggctggacaatcttcttctaggcagcatgcttcgaggccggaagca
acacctttagattttgttatacgaccccaatctaaaattgatcccgacgagattagagcc
cgggcaaagcaagctgcccaagatcaacagcgtatgaagatgaataagaaattgcagcaa
ttgagggcaccaaaaaagaggcagctccaggctacaaaactgagtgtggaaggtcgtggt
atggtcaaatatttgtaa

DBGET integrated database retrieval system