KEGG   Phaseolus vulgaris (common bean): PHAVU_009G177500gHelp
Entry
PHAVU_009G177500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K06195  ApaG protein
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PHAVU_009G177500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR
Motif
Other DBs
NCBI-GeneID: 18620496
NCBI-ProteinID: XP_007138063
UniProt: V7AWM8
Position
9
AA seq 285 aa AA seqDB search
MMQSLLSAKTCVGMLSPVITNSEERSRRRMMQRVNCRNSRNWRNVAVSCGSGKNGNEGIG
ASEGWNSGSFLSPSHNYAILKHRMEIAAKSEFYEEAARIRDSLKCFEDEVPVLRLRRLLK
EAVADERFQDAAKYRDQLKEIAPHSLLKCSSDCTTLGIRVQVKSVYLEGRSESTAEEVYF
FEYKIRITNNTNRPVQLLRRHWIITDANGKTENFWGIGVGGEQPAIFPKSSFEFSSTCPL
NAQNGRMEGNFELIHVDRVGPRAFSVDVAPFSLSLLGDGDDGEII
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagtcgttgttgagcgcgaagacatgcgtgggtatgctgtcaccggttataacg
aactccgaagaaaggagtaggaggaggatgatgcagagagtgaattgtagaaacagtagg
aattggaggaatgtggctgtgtcgtgcggttcggggaagaacgggaacgagggaattggc
gcgagtgaagggtggaattcgggttcgtttttgtctcctagtcacaattacgcgatcttg
aagcaccggatggagatagcggcgaagtccgagttttatgaagaggctgcaaggattcgt
gactcgctcaaatgcttcgaggacgaggttcctgttctgcgtctgcggaggttgttgaaa
gaagctgttgctgatgagagatttcaggatgcagctaaatatcgtgatcagctcaaagaa
attgctccacattctctcttaaaatgttcaagtgattgtacaaccttgggaattcgagta
caagttaagagtgtatatttagagggcagaagtgaatcaacagcagaggaggtatatttc
tttgaatataaaataagaattactaataacacaaaccgccctgttcagctcctcagaagg
cactggattataaccgatgctaatggaaaaactgaaaatttctggggaattggggttggt
ggtgaacagccagctatatttcctaagagtagttttgaattctcttctacatgcccttta
aacgcacaaaatggtagaatggaaggtaactttgagctgatacacgttgatcgagtaggt
ccaagagcatttagcgtggacgttgcccctttttctctctctctacttggagatggtgat
gatggtgaaattatctga

DBGET integrated database retrieval system