KEGG   Phaseolus vulgaris (common bean): PHAVU_010G051300gHelp
Entry
PHAVU_010G051300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00350  Tyrosine metabolism
pvu00360  Phenylalanine metabolism
pvu00380  Tryptophan metabolism
pvu00950  Isoquinoline alkaloid biosynthesis
pvu00965  Betalain biosynthesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PHAVU_010G051300g
   00360 Phenylalanine metabolism
    PHAVU_010G051300g
   00380 Tryptophan metabolism
    PHAVU_010G051300g
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    PHAVU_010G051300g
   00950 Isoquinoline alkaloid biosynthesis
    PHAVU_010G051300g
   00965 Betalain biosynthesis
    PHAVU_010G051300g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvu04147]
    PHAVU_010G051300g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     PHAVU_010G051300g
    4.1.1.105  L-tryptophan decarboxylase
     PHAVU_010G051300g
Exosome [BR:pvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHAVU_010G051300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 DUF1148 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18617476
NCBI-ProteinID: XP_007134487
UniProt: V7AQJ2
Position
10
AA seq 496 aa AA seqDB search
MNPLDPKEFRRQGHMMIDFLADYYQNVGNYPVLSQVEPGYLRNLIPDFAPLKPEPIETIL
QDFQQHIVPGITHWQSPNYFAYFPSSGSTAGFLGEMLSTGLNLVGFNWVSSPAATELESV
VMDWLGQVLKLPKAFLFSGNGGGVLLGTTCEALLVTLVAARDKMLSRIGRENICELVVYV
SDQTHCAVQKAAHIIGIQPKNIRVIKTMKSTSFTLLPESLLSAIQTDVQNGLVPCYLCVT
VGTTSTTAVDPLGPLCKVAKKYGMWVHVDAAYAGSVCICPEFRHLIDGVEDANSFSFNAH
KWFLTNLDCCCLWVKDPASVIKSLSTHSVYLENSATDSKQVVDYKDWQITLSRRFRALKV
WLVLRSYGVANLRNFLRSHVEMAKTFEKLVRRDKRFEIFVPRNLALICFRLLPSAVAKIG
NGKVQNGGFKNEDVANDINRRLLDSINGSGTVYMTHAIVGGVFVIRCAIGATLTETKHVI
MAWKVVQEYADAILNY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttagatcctaaagaatttaggaggcaagggcacatgatgattgacttcctt
gctgattattaccagaatgttggcaactatccagtgttaagtcaagtagagccaggttat
cttagaaatctcataccagattttgcccctctcaaacctgaacctattgaaaccatcctt
caagattttcagcagcacatagttcctggcataacacactggcaaagccctaattacttt
gcctactttccctccagtggcagcacagcagggtttcttggtgagatgctgagcacagga
ttgaacttggtagggttcaattgggtgtcatcaccggctgcaacagagctagaaagtgtc
gtcatggattggctgggccaggtgctgaagctccccaaggcttttctcttttcaggtaat
ggtggaggcgtgttgttagggacaacatgtgaggcccttttggtcacactagttgctgct
agagataaaatgcttagccgaattggtagagaaaatatttgtgagctagtcgtttatgtg
tctgatcaaacacattgtgctgttcagaaagcagctcatataataggaattcaacccaaa
aatattagggtaatcaagactatgaagtctacttctttcactttattgccagaatcactg
ttatccgccattcaaacagacgtgcaaaatgggttggttccttgttatctttgtgtcaca
gtgggcacaacttcaaccactgctgttgatccattgggaccactgtgcaaggtggcaaaa
aaatatggcatgtgggtccatgttgatgctgcttatgctggtagcgtgtgcatttgtcct
gagttcagacacttgattgatggagttgaggatgcaaactcgtttagtttcaatgctcac
aaatggtttctcactaacttagattgttgctgtctttgggtgaaggatccagcttctgtg
ataaaatccctatcaacacattcagtgtatttagagaacagtgctactgattcaaaacaa
gtggtggactacaaggattggcagataaccttgagcagaagattccgtgcactaaaagtt
tggcttgttctgagaagctatggtgttgctaatcttagaaacttcctcagaagccacgtt
gaaatggccaagacttttgaaaagttggtgagaagggacaaaagatttgagatctttgtg
cctagaaatcttgctctgatttgctttaggcttttaccttcagcagttgcaaagattggt
aatggcaaggttcaaaatggaggtttcaaaaatgaggatgttgcaaatgatatcaaccgt
agattgctggattcaatcaatggttcaggcactgtgtacatgactcatgcaattgttgga
ggggttttcgtgattaggtgtgccataggagcaaccctcactgaaacaaaacatgttatc
atggcctggaaggtggtgcaggaatatgcagatgccattcttaattactga

DBGET integrated database retrieval system