KEGG   Phaseolus vulgaris (common bean): PHAVU_011G1776001Help
Entry
PHAVU_011G1776001 CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvu04131]
    PHAVU_011G1776001
Membrane trafficking [BR:pvu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    PHAVU_011G1776001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
NCBI-GeneID: 18616534
NCBI-ProteinID: XP_007133425
UniProt: V7AIP2
Position
11
AA seq 471 aa AA seqDB search
APMMTMDRYAAAESFYKLAMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVV
MQALVARNDGVWSKDHVAALRKICPMVSNEITSEASAAEVEGYGASKLTVDSAVKYLQLA
NKLFSQAELFHFCASILELVIPVYKSRRAYGQLAKCHTLLTNIYESILEQESSPIPFTDA
TYYRVGFYGDRFGKLDKKEYVYREPRDVRLGDIMEKLSHIYESRMDGNHTLHIIPDSRQV
KAEELQPGVCYLQITAVDPVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGK
NQGGLEDQWKRRTVLQTEGSFPALVNRLLVNKSESLEFSPVENAIGMIETRTAALRNELE
EPRSSEGDQLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAAL
LEFMAVCKRAIRVHFRLIGDEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gcccccatgatgactatggatagatatgccgccgctgaaagcttctataaattggccatg
gcatttgccccagtccctgatcttcacataatgtggttgcttcatctatgtgatgcacat
caggaaatgcaatcttgggcagaagctgctcagtgcgctgtcgcagttgctggtgttgta
atgcaggcccttgttgccagaaatgatggtgtatggagcaaagaccatgttgctgctcta
cggaagatttgtcctatggtcagcaatgagatcacctctgaagcatctgctgctgaggtt
gagggatatggggcttcgaaactgactgttgactctgctgtgaaatacttgcagcttgct
aataagctcttctcacaagctgagctttttcatttctgtgcaagcattcttgaacttgta
atcccagtttacaaaagtaggagggcttatggacagctggctaaatgtcacacgttactt
accaatatctatgaatcaattcttgaacaggaatctagtccaattccttttacagatgca
acatactacagggttggattttatggtgataggtttgggaaacttgataaaaaggagtat
gtgtatcgtgagcctcgtgatgtacgtctaggtgacataatggaaaaacttagtcacata
tacgagtctagaatggatggtaatcacactttgcatattattccggattctagacaagtg
aaggcagaggagttacagcctggtgtctgttaccttcagattactgctgttgatccagtc
atggaagatgaagatttgggaagtaggagagaaagaattttctctctctctactggaagt
gttcgagcccgggtatttgaccgattcttgtttgacaccccatttaccaaaaatggaaag
aatcaaggtggattggaagatcaatggaagagacgcactgttcttcagactgagggttcc
tttccagctttagtaaatagactattggtaaacaaatccgagtccctcgaattctctccg
gtagaaaatgcaatcggaatgattgaaacacgaacagctgccttaagaaatgagcttgaa
gagcctcgaagttctgagggtgatcaacttccaagactccagagtctacaaagaattctc
caaggcagtgttgcagtccaagtgaatagtggagtgttgagtgtttgcacagccttcttg
tctggggagcctgcaacaaggctgcggtcacaggaactgcaacaacttatagcagccctt
cttgagttcatggctgtttgtaaacgtgcgatccgcgtacacttcagattgattggcgat
gaagatcaggatttccatacacagcttgttaatggtttccagtcactaacagcagagtta
tcacattacatccctgccattctctcagagctatga

DBGET integrated database retrieval system