KEGG   Phaseolus vulgaris (common bean): PHAVU_011G187800gHelp
Entry
PHAVU_011G187800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHAVU_011G187800g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PHAVU_011G187800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18616642
NCBI-ProteinID: XP_007133542
UniProt: V7AMZ8
Position
11
AA seq 296 aa AA seqDB search
MLELPLNMALRFPNLDLQSLPFAQNLNPELLGAIVALLALGFTAAYKYLTRPPKGCLDPE
NFKEFKLIKKTQLSHNAARFRFALPTPSSILGLPVGKNILVRGIDSEGEEVKRSYTPITL
DSDVGYFELVVKMYPNGKMSHHFREMKEGDYLSVRGPKGRFSYKPGQVRAFGMIAGGSGI
TPMFQIIRAILENPKDKTKVHLIYANVTVEDILLKEELDNFADKFPRRFEVYHVLNKAPP
EWNGGIGFISKEIIKSHCPQPAQNIQILRCGPPGMNIAMATHLDELGYTSNMQFQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttggaactaccattgaacatggctcttcgattccccaatttggatttgcagtctctg
ccatttgcccagaatctgaaccctgaactgcttggtgccattgtagctcttcttgctctt
ggcttcactgcagcttacaaatatctcaccagaccacctaaaggatgtttggaccctgaa
aatttcaaagaattcaaactgataaagaagacacaacttagccacaatgctgcaagattc
agatttgctcttcctactccttcttccatattgggtcttcctgttggaaaaaatatactt
gttagaggaatagatagcgaaggagaagaagttaagagatcatatactccaatcacgttg
gattcagatgttggatacttcgaattggttgtgaagatgtacccaaatggaaagatgtcc
caccattttagagaaatgaaggaaggtgattatttgtctgtgaggggtccaaagggacgt
ttcagttacaaacctgggcaagttagggcatttggaatgattgctggaggctcaggcata
actccaatgtttcagatcataagagccattctagaaaaccctaaagacaaaacaaaggtg
cacctaatttatgccaatgtaacagtggaggacattctgttgaaggaagaactagataat
tttgcagacaaatttcctcgcagatttgaagtctatcatgttcttaataaggctcctcca
gaatggaatggtggcattgggtttatatcgaaggagattattaaatcacattgccctcaa
ccagcacaaaatattcagatactaaggtgtggtccaccaggtatgaacatagccatggct
actcaccttgatgaacttggctacacatcaaacatgcagtttcagttctaa

DBGET integrated database retrieval system