KEGG   Plasmodium vivax: PVX_083035Help
Entry
PVX_083035        CDS       T01073                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase, putative
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pvx  Plasmodium vivax
Pathway
pvx00010  Glycolysis / Gluconeogenesis
pvx00020  Citrate cycle (TCA cycle)
pvx00620  Pyruvate metabolism
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_083035
   00020 Citrate cycle (TCA cycle)
    PVX_083035
   00620 Pyruvate metabolism
    PVX_083035
Enzymes [BR:pvx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PVX_083035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_29
Motif
Other DBs
NCBI-GeneID: 5473491
NCBI-ProteinID: XP_001614206
UniProt: A0A1G4HGD0 A5K865
Position
12
AA seq 599 aa AA seqDB search
MMENVVAKTVESTLKKSIDKSSDYDLAEKMEDMKKVIIEEVRRNLVYNKPVGPIMSSKDI
LTLSQEQESKFNEEVHELGLHVNRIHHNSTPAFLYEMALKYESNSFITSTGALCCISGEK
TGRSPSDKRIVKESSSEENIWWGKVNIPLKEKSYEINKGRAIDYLNLQPNLYVIDAYAGW
DENCRIKIRVITSRAYHALYMLNMLIPPKNVEEIQNFIPDFIIYNAGDFPSNRLTDGMSS
QTSVIINFGAMNMIILGTQYAGEMKKGILTLFMYKMPLEGKLPLHSSCNVGKNNDVTLFF
GLSGTGKTTLSADANRYLIGDDEHVWTDDGIFNIEGGCYAKCKGLSKKQEPEIYKAIKFG
AILENVVMDPVTREVDYNNCTITENTRCAYPLSYIENAKIPAYVHTHPQNIILLTCDAFG
VIPPLSKLDVYQMMYHFVSGYTSKMAGTESDVLKPTATFSSCYAAPFLALHPMVYAKMLA
EKYQKHKANVWLLNTGWIYGSYGSQNGQRIPLKYTRMLVDYIHENKLIDIEYKKTPIFNF
NIPARVEGIPEEVLDPLVGWKDKEDYMKNLQNLAREFISNFALFSDKAGPDILSGGPAL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaacgtggttgcaaagacggtggaaagcacactgaagaagtcgatagacaag
tcgtcagattacgacttggcagaaaaaatggaggacatgaaaaaggtaataattgaggag
gtgcggagaaacctggtgtataacaaaccggtgggacccatcatgagctcgaaggatatc
ctaacgttaagtcaagagcaggaaagtaaatttaacgaagaggtacacgagctgggattg
catgtgaataggatacaccacaattcgacgccagcttttctgtacgaaatggcattgaaa
tatgagtccaattcgtttataaccagcacaggagcgttatgctgcatttctggagagaaa
acagggaggtctccatcggacaagcggattgtgaaggagagttcctcagaagaaaacatc
tggtggggaaaagtgaacattcctttgaaagaaaaatcttacgaaataaacaaaggcaga
gcgatagactacctaaatttgcagccaaacttgtacgttatagatgcctatgcaggttgg
gatgaaaattgcagaatcaaaatcagagtgattacttctagggcttatcatgcactgtac
atgctgaatatgcttatccccccaaaaaatgtagaagaaatacaaaattttatcccagat
tttattatatataatgctggggatttcccttcaaacagattaacagatggaatgtccagc
caaacatccgtcatcataaatttcggtgcaatgaatatgatcatattgggaactcagtac
gctggagaaatgaaaaaaggaattttaaccctttttatgtataagatgccattggaaggg
aaactacctctacactcttcctgcaatgttgggaagaacaacgacgtgactttattcttt
ggactctcaggcacgggaaagacaaccctctctgctgatgcgaataggtatctcataggg
gatgatgaacatgtgtggacagacgatggcatattcaacatagaaggtgggtgttatgca
aaatgtaagggcctttcaaaaaaacaagaaccagagatttataaggcaatcaaatttggg
gctattctcgaaaatgtggtaatggacccagtcaccagagaagtagattataataactgc
acaattacagaaaatacacgatgtgcttatcctttgtcctacatagaaaatgcgaagatt
cccgcgtatgttcatacccatccgcagaatattatcctgctgacctgtgatgcctttgga
gttattcccccgctatccaagctggatgtataccaaatgatgtaccatttcgttagtggg
tatacgagcaaaatggctggcacagaaagcgacgttttgaaaccaacagctaccttctcc
tcgtgttatgccgctcccttcttggctctccaccctatggtgtacgccaaaatgttggcg
gagaaatatcagaagcataaggccaacgtatggctgttaaatactggctggatttatggc
tcgtacggttcgcagaatgggcaacggatccctttgaagtacacgcgcatgttggtggac
tacattcacgagaataagctgatcgatattgagtataagaagacgcccatttttaacttt
aacatccctgcccgcgtggagggcattcccgaggaagtcctcgaccccctcgtcgggtgg
aaggacaaggaggactacatgaagaacctccagaacttggccagggagttcatcagcaac
tttgccttgttctcggacaaggccggcccggacatcctctcgggggggcccgccctctaa

DBGET integrated database retrieval system