KEGG   Plasmodium vivax: PVX_093605
Entry
PVX_093605        CDS       T01073                                 

Definition
(RefSeq) serine/threonine protein phosphatase 2b (catalytic subunit), putative
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pvx  Plasmodium vivax
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvx01009]
    PVX_093605
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PVX_093605
Protein phosphatases and associated proteins [BR:pvx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     PVX_093605
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 5471505
NCBI-ProteinID: XP_001608591
UniProt: A0A1G4H6K2 A5KCI8
Position
1
AA seq 564 aa
MEPLPNPKNDRQVKDVEPPPAKPLSLELLYPNGTDEPPDYKALRDHLKKEGRIRKEDCLD
IIKRVIDIVSNEPNLLRLQDPITIVGDIHGQYYDFLKLLEVGGNPDNTQFLFLGDYVDRG
SFSIEVLLLLYALKINFPHKIWLIRGNHECRQMTSFFNFRDECEYKYDMVVYYAFMESFD
TIPLSAVINGKFLAVHGGLSPQLVLLNQICSFTRFQEPPRSGIFCDILWADPIDEDKEEH
TIQTESYFPNDIRGCSYFFGYNAATTFLEKNGLLSIIRAHEAQLEGYKMHQTNLKTGFPI
VITIFSAPNYCDVYNNKGAVLKFDSNTLNIQQFSFSPHPYHLPNFMNLFTWSLPFVSEKV
TEMLYCILNSSVNQSDEGVKDVVLPAEVLQIISYIEENNVKLEGMTLSGGGGATAGAAST
GATEGSPSSQRKEALFKEGCFHSGASKEGGALGTTSPAAATATTQQMAAQGEQPAHLHTD
DAQASKERSDALRKKVQSVGRLMRVFRTLRKENELIVQLKGCSPGYRIPVGLLLQGKEGL
ENELEKFTKAKQIDSINEKRPPNE
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggagcctctaccaaaccctaagaacgatagacaagtgaaagacgtggaacccccacca
gctaagccgctgagcctggagctgctgtacccgaacggcacggacgagccgccagactac
aaggcgctgcgcgaccacctgaagaaggaggggcgcatccgcaaggaggactgcctagac
atcatcaagagggtgatcgacatcgtgagcaacgagccaaacctgctgcggctccaagac
ccaataacgatcgtgggggacatccacggccagtactacgattttctgaagctactggaa
gtgggaggaaacccagataacactcagttccttttcctgggcgactacgtagacagaggt
tccttcagtatagaggtcctgctcctcctctacgccctcaaaattaatttcccacataaa
atatggctcataagaggaaatcacgagtgtaggcagatgacctccttcttcaattttaga
gacgaatgcgaatacaaatacgatatggttgtgtattatgcctttatggaatcctttgat
acgatccccttatcggctgtaatcaatgggaagttcctagccgtccatggggggttgtct
cctcaactggtactcctcaatcagatatgttccttcacgagattccaagaacccccacgg
tcagggattttctgtgacattttatgggcggacccaattgacgaagataaagaggagcat
accattcagacggaatcctacttccccaatgacatccgagggtgtagctacttctttggc
tataatgctgccaccacctttttagagaagaacgggttactctccattataagagctcat
gaggcacagttggagggatacaaaatgcatcaaaccaatttgaagaccggcttccccata
gtcatcaccatattttctgcccctaattattgtgacgtttataataacaagggggctgta
ctcaaattcgatagcaacacgttgaacatccaacagtttagcttttccccccacccgtat
cacctccccaattttatgaacctcttcacctggtctctcccctttgttagcgagaaagtc
acagaaatgctctactgcattttaaactccagcgtcaaccaatcggatgagggggtgaag
gacgtcgtgcttcctgcggaggtcctccagattattagctacatagaggagaacaatgtc
aagctggaggggatgactctaagtggtggtggtggtgctactgccggtgctgcttctacc
ggtgctaccgaggggtccccctcctcacagaggaaggaagcccttttcaaggagggctgc
ttccacagtggggcatccaaagaagggggggcattgggaacaacctcccccgctgccgct
actgcgactacgcagcaaatggccgcccagggggagcaaccggcccacctgcacaccgat
gacgcgcaggcgtccaaggaacggtccgacgccctcaggaaaaaggttcagtcagttggt
cgcctgatgagagtgtttaggacgctgcgcaaggagaacgagttgattgtgcagctcaag
gggtgcagccccggctaccgcatccccgtgggcctcctcctgcagggcaaggaggggctg
gagaacgagctggagaagttcaccaaggccaagcagatcgacagcataaatgagaagcgg
ccgccgaacgagtag

DBGET integrated database retrieval system