KEGG   Plasmodium vivax: PVX_100950Help
Entry
PVX_100950        CDS       T01073                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-coenzyme A hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pvx  Plasmodium vivax
Pathway
pvx00280  Valine, leucine and isoleucine degradation
pvx00410  beta-Alanine metabolism
pvx00640  Propanoate metabolism
pvx01100  Metabolic pathways
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PVX_100950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PVX_100950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PVX_100950
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PVX_100950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 5473217
NCBI-ProteinID: XP_001613936
UniProt: A5K8R3
Position
14
AA seq 516 aa AA seqDB search
MQKLGSRLHLGEAKCGRRGFQHYVVKPERGGSLFCARHFFAREANPQSELNGAPFCERRQ
VSGFFTKARNNCSVDGKGRNEILFEKMEKKDSNILHMTKQSVSSEKAATVDSAKGGSGEG
EPLLKHGDEDKVASRKGENQSREPLPPVIDLELSEVWSKKTLILNFKNSVFEIILNRPEK
LNAINKDMINGLLNIVKSLNSDDRCHLIIIKSSNTTCFCSGSDVKDIVQNKEKGMQHLKQ
LYMYIHYLSKMKKPVLCIWNGYAMGGGLGISMYAKFRVINKKAIFAMPENKIGFFPDISC
SYFFKKYFGRNIGLHLGLTSLRLNEADLVNFKICSNYVEDVGGLLNEIYNIGRPNQKEFE
RELSTILGKYPPKVTTETKPVLTHELISNIDRYYSVAANLNDLLSKLKKDQRNPFCQQTL
EAINQNCLSSCNLWFEYFLYNYDKPLEEVLDNDFKITQHFLYHTDTFEKGVTELLVKKNK
SFKWSSARESGDLHAGPSVEDILTNSGLLSIRGELT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaggctcgcgactccatctgggagaggccaagtgcggaagacggggcttt
cagcattatgtagtcaagcctgagaggggcggctctcttttttgtgcgcgccattttttt
gccagagaagccaacccgcagagtgagttgaacggcgctcccttctgcgaaaggagacaa
gtcagcggcttcttcaccaaagcgaggaacaactgctccgtcgatggaaaaggaagaaat
gaaatactttttgaaaaaatggaaaaaaaagatagcaatatactccatatgacgaagcag
agcgtgtccagtgagaaagcagccacagtcgattctgcgaaagggggaagcggggaagga
gagccacttctaaaacatggggatgaagacaaagtggccagtcgaaagggggagaaccaa
agtagggaacccctccccccagtcatagacctagaactgtccgaagtgtggtccaaaaaa
acgctcattctaaatttcaaaaatagcgtattcgaaataattttaaacaggccagaaaag
ctaaacgcaattaacaaagatatgattaacgggttgctaaacattgtgaagagcctaaac
agcgatgataggtgtcacctgatcatcataaaaagtagcaacacgacgtgcttctgctcc
ggttccgatgtcaaggacattgtccaaaataaagaaaaagggatgcagcatttgaagcag
ctctacatgtacattcactacttatccaaaatgaaaaaacctgtcttgtgcatatggaat
ggttatgctatgggaggaggtttagggatttccatgtatgcaaaatttagggtaataaat
aagaaggccatatttgccatgcctgaaaataagattggcttcttcccagatatcagttgc
tcctacttttttaaaaaatatttcggaaggaacattgggctgcatctagggttgacatcc
ctacgattaaacgaagcagatttagtcaactttaaaatttgcagcaattacgttgaagat
gtgggtggactgctcaacgagatttacaacattgggaggccaaaccagaaggagttcgag
agggaactctccaccattttaggcaagtaccccccgaaggtcactacagagacgaagccg
gtacttacccacgagctgattagcaacattgataggtactacagtgtggccgctaaccta
aacgatcttcttagcaagttgaagaaggaccagcgcaaccccttttgccaacaaacgcta
gaagctataaaccagaactgcctctccagctgcaacttatggtttgagtatttcctttac
aattacgataagcccctggaggaggtgctggacaacgattttaaaattacgcagcatttt
ttgtaccacacagatactttcgagaagggcgtaacggaactgctcgtgaagaaaaataaa
tccttcaagtggagctccgcgcgggaaagtggcgatctgcacgcgggtccaagcgttgaa
gatattctgacgaacagcgggttgctgtccattcggggggagctcacatga

DBGET integrated database retrieval system