KEGG   Plasmodium vivax: PVX_113330Help
Entry
PVX_113330        CDS       T01073                                 

Definition
(RefSeq) dihydroorotate dehydrogenase, mitochondrial precursor
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
pvx  Plasmodium vivax
Pathway
pvx00240  Pyrimidine metabolism
pvx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PVX_113330
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     PVX_113330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHO_dh NMO FMN_dh
Motif
Other DBs
NCBI-GeneID: 5475357
NCBI-ProteinID: XP_001616058
UniProt: A5K1N1
Position
11
AA seq 572 aa AA seqDB search
MLRHSCLREKGNLIGGSLLRGISAQLRAAGGGTFRSFHSYRSFCSFCIFRRANKADANWY
GCFPGHVAGGATCGPLRGDCAERHKLMAHVRRFSGESTRAKGGDKREGDIEGNRTNGSDK
TKQLEEEMKKLNEQIAREKGNHKKALLFIFTCVVALYMYFESYDPEFFLYDVFLKMLLKY
VDGETCHELFLLMGKYKLLPYDTGKDNIYSCSEIKGLNFINPFGVAAGFDKNGVCIDGIL
KLGFSFIEIGTITPKAQKGNERPRIFRDLETRSIINSCGFNNMGCDEVCKNLKRFRERQK
TDKLLQRHLVGVSLGKNKDSPDILQDLSYCIGKIGRYADYIAINVSSPNTPGLRDHQKGE
RLHGIIQRVKEEVAKLDGGGAPLGGATTGGAAMGGATTGEAVVGKAPPDEAATGGEPWAN
TTKRRPLIFVKLAPDLEEGERKSIANVLLNAEVDGMIICNTTTQKFNIKSFEDKKGGVSG
EKLKGVSTHMISQMYNYTNGKIPIIASGGIFTGEDALEKIEAGASVCQLYSCLVFNGMKA
AVRIKRELDHLLYQRGYYKLGDAVGRAHRRAA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgacatagctgcctgcgcgagaaggggaacctaattggggggagcctcttgcgg
ggcatcagcgcccagctgcgcgctgcagggggtggcaccttccgaagcttccacagctac
aggagcttctgtagcttctgcattttccgccgggcgaacaaagctgacgcgaactggtac
ggctgcttccccggccatgttgcggggggagcaacctgcggaccgctccgaggggactgc
gcggagaggcacaagttgatggcgcacgttcggaggttcagcggtgagtcgactcgcgcc
aaagggggagacaaaagagaaggtgacatagaggggaatcgaaccaacgggagcgataaa
acaaaacaactggaagaagaaatgaagaagctgaatgagcaaatagcgagggaaaagggg
aaccacaagaaagccctccttttcatttttacatgtgtagtagctctatacatgtatttc
gagtcctacgaccccgaattttttctgtatgatgtatttttaaaaatgcttttaaaatat
gttgatggggagacatgccatgagcttttcctcctcatggggaagtacaagctgttgccc
tacgacacgggaaaggataacatttactcttgctcagaaataaaaggattaaattttata
aatccatttggagtagctgcaggatttgataagaacggggtgtgcattgatgggatttta
aagttgggtttttcttttatagaaattgggaccatcactcctaaggctcagaagggaaat
gagaggccaaggatcttcagagatttggaaacgaggagcattataaattcctgtggcttt
aataacatgggttgtgatgaggtgtgtaagaatttgaaacgctttcgggagaggcagaag
acagacaagctgctgcagagacatttggtgggcgtcagtttggggaagaacaaggactcc
cctgatattttgcaggacctcagttattgcatcgggaagatcggcaggtacgcggattac
atagccatcaatgtgagttcccccaatacccccgggctgcgcgaccaccagaagggggag
cgcctgcacgggattattcagcgcgtgaaggaggaggtggccaagttggacggggggggg
gcgccccttggaggagcgaccactgggggagcggccatggggggagccaccactggagaa
gcggtcgtgggtaaagctccccctgacgaagctgccacaggtggcgagccctgggcgaac
acgaccaagcgcaggcccctcatcttcgtgaagctggcccccgacttggaagaaggcgaa
agaaaaagcatcgcaaacgtgctgctcaacgcggaagtagacgggatgatcatttgcaac
accacgacgcaaaaatttaacataaaaagttttgaagacaaaaaaggaggagtcagtggg
gaaaagttgaagggcgtgtctactcatatgatttctcaaatgtataattacacgaatggg
aagatccccataattgcatctggggggatattcacgggggaagatgcgctggagaagatc
gaggcgggtgcgtccgtgtgccagctgtactcctgtctggttttcaatgggatgaaggcg
gccgtgcggattaagcgcgagctggaccacttgctttaccagcgggggtactacaagttg
ggggacgccgtcgggcgggcccaccggcgggccgcctag

DBGET integrated database retrieval system