KEGG   Plasmodium vivax: PVX_113980Help
Entry
PVX_113980        CDS       T01073                                 

Definition
(RefSeq) malate:quinone oxidoreductase, putative
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pvx  Plasmodium vivax
Pathway
pvx00020  Citrate cycle (TCA cycle)
pvx00620  Pyruvate metabolism
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PVX_113980
   00620 Pyruvate metabolism
    PVX_113980
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PVX_113980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mqo DAO Pyr_redox_3 Pyr_redox_2 NAD_binding_8 Peptidase_A2E
Motif
Other DBs
NCBI-GeneID: 5475483
NCBI-ProteinID: XP_001616184
UniProt: A5K207
Position
11
AA seq 481 aa AA seqDB search
MLRVKSVFCRYRRQARHVSSGEELAAGVYDTVVIGGGVTGTALLFLLSKFTNLKKLAILE
RRSDFALVASHGKNNSQTIHCGDIETNYSFEKAKFIKRYADLLRNYLCHLPAEKREGISS
VTQKMVLGVGEKECSFLEERYPVFRKLFKPMKLYGKSDIHSVEPRVVLKNENTLREETLA
ALYMPPELTTCDYQKLSNSFVECARSMNGVDSKKISINLNTEVTNIEEANESLYIIHTNR
GFIKSRFVVVCACGHSLMIAQKMNYGLEYSCLPVAGSFYFSGNVLNGKVYTIQNPALPFA
AVHGDPDIIEKGKTRFGPTALPLPLLERDNMNTLVDFLKVWNPDLSLFHVYFNLFKDMTM
LKYVCRNFLFEIPILNKYLFLKDVRKIIPSLTTRDLSYCVGYGGVRPQLINKVSKKLILG
EGKIDPGKNIIFNITPSPGATTCLGNGESDMNIICERLNGTVDRPAVRKFLYQGDYPVDY
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagtgaagagcgtgttctgcaggtacaggagacaggcgcgccacgtgagcagc
ggggaggaactagcggcgggcgtgtacgacacggtggtcatcggggggggcgtgacaggc
acagcgctgctcttcctcctgtccaaatttaccaacctgaagaagctagccatcctagag
aggaggagcgacttcgccctggttgcctcccacggaaagaacaacagccagacgatccac
tgtggagatatagaaacgaattactcatttgaaaaggcaaagtttataaaacgctatgca
gatttgttacgaaattatttgtgccatttgccagcagagaagcgagagggaatttccagt
gtaactcaaaaaatggtgctcggggtgggtgaaaaggagtgtagtttcttggaggaaagg
taccccgtatttaggaagctgttcaaaccgatgaagctgtatggcaaaagtgacatacat
agtgtggagccccgagtggttttaaaaaatgaaaatactctccgagaggaaacgttagca
gcgttatacatgccaccagagctgacgacgtgtgactatcaaaagctatcaaacagtttc
gtcgagtgtgctagaagtatgaatggggtagactcgaagaagatctccatcaacctaaat
acagaagttacaaacatagaagaagcaaacgagtcgttatacataattcataccaacaga
ggatttattaaatctcgattcgtcgtcgtttgtgcatgtgggcactctctcatgatagct
caaaaaatgaattacggcttggaatacagctgtcttcccgtagccgggagtttctacttc
tctgggaacgttcttaatgggaaagtctacaccatacagaacccggctctcccatttgca
gccgtacatggggacccagatattatagagaaagggaagactcgcttcgggcctactgct
ctcccactgccactactagagagagataacatgaataccctagtggacttcctaaaagtc
tggaacccagatttgagtctctttcacgtctattttaacctttttaaagacatgaccatg
ctcaagtatgtctgtaggaacttcctttttgaaatccccatccttaacaagtaccttttt
ttgaaggacgtccggaaaatcattccctccttgaccactcgggatctctcctactgtgtt
ggctacgggggggtcaggccacaactcataaacaaagtgagcaagaaactcatcctgggg
gaggggaaaatcgacccggggaaaaatatcatttttaacatcacgccctcccccggggcc
accacctgcttggggaacggcgagagtgacatgaacattatatgcgagcgcctcaacggt
accgtcgatagacccgccgtgcggaagttcctctaccagggggactaccccgtcgattac
ttgtag

DBGET integrated database retrieval system