KEGG   Plasmodium vivax: PVX_122420Help
Entry
PVX_122420        CDS       T01073                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pvx  Plasmodium vivax
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 UspB
Motif
Other DBs
NCBI-GeneID: 5476355
NCBI-ProteinID: XP_001617046
UniProt: A5JZA8
Position
14
AA seq 154 aa AA seqDB search
MNVARNKKNNLIDDELPNDFVLPKGDKVKGEKLFKKHCKQCHSIAPDNTQSNSGFTSWGP
SLFNVYNRTAGMSRGNSPFQVSPDMYASGIIWNDLNLMKYMRNPKDFVEANIGMNFKGIS
NFQDRVDIVHYLKTLTYDDPHGREIVEKFSKKKK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagccaggaataaaaagaacaacctgatagatgacgaactaccaaatgatttt
gtgctacccaagggagacaaagtaaaaggggagaagctattcaagaagcactgtaagcaa
tgtcactccatagcccccgacaacacacaatccaattcggggttcacgagttggggtccc
tccttatttaatgtttataacagaacggctggaatgagcagaggcaattcgccttttcaa
gtatcacctgatatgtacgcgtcaggcattatatggaatgacttaaatttaatgaagtac
atgaggaaccccaaagattttgtagaagcaaacattggtatgaactttaaaggaatttca
aattttcaagatagggttgacatcgttcactatttaaaaacccttacgtatgatgaccca
catgggagagaaattgtggaaaaattttccaaaaaaaaaaaataa

DBGET integrated database retrieval system