KEGG   Plasmodium vivax: PVX_122850Help
Entry
PVX_122850        CDS       T01073                                 

Definition
(RefSeq) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pvx  Plasmodium vivax
Pathway
pvx00020  Citrate cycle (TCA cycle)
pvx00310  Lysine degradation
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PVX_122850
  Amino acid metabolism
   00310 Lysine degradation
    PVX_122850
Enzymes [BR:pvx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PVX_122850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5476442
NCBI-ProteinID: XP_001617133
UniProt: A5JZJ5
Position
14
AA seq 415 aa AA seqDB search
MTQNLVLRLNKPLFYNAKGISRILNLECKQCVNCHSTFKRCFSIDTIKVPRLGDSITEGT
ISEWKKKVGDYVKVDETITIIDTDKVSVDINSKSSGALSKIFAEAGDIVLVDAPLCEIDT
SVEPPAHISEVKEEIAQSKTVQASEQNGSEKEEGKKDQNSAHKESERKVSEANNTRVLYE
AVSERTETRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKVIVLRSELKDIFQKKYG
CKLGFVSLFMHASTLALKKMPQVNAYIDNDEIVYRNYVDISVAVATPNGLTVPIIRDCQN
KKLSELELALSELATKARNNKLSLDDFTGGTFTISNGGVFGSMLSTPIVNMPQSAILGMH
TIKDRAVVVNNEIVIRPIMYLALTYDHRLLDGRDAVQFLSAIKDYIENPSLMLID
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaccttgtgcttcgattgaacaaacccctgttttataacgcgaaagggatt
agcaggatcctcaacctggagtgcaagcaatgcgtgaactgtcattccacatttaaaaga
tgcttctccatagacacgataaaagtacccaggcttggagattccattacggaaggcacc
atcagcgaatggaagaaaaaagtgggtgattatgttaaggtggatgaaacgataacgatt
atcgacacggacaaagtaagcgtcgacataaactccaaatccagtggggcgctttcaaaa
atatttgcagaagcgggagacatcgttttggtcgatgcgcccctgtgcgaaatagacact
tcagtggagccacctgctcacatatcagaagtgaaggaagaaatagcacaaagcaaaact
gtgcaagcgagtgaacaaaatggaagcgaaaaggaggaaggtaaaaaggaccaaaatagc
gcgcacaaagaaagcgaaagaaaagtaagtgaagcgaataacacaagagtgctatacgaa
gccgtcagtgaaagaaccgaaacgagagtgcgcatgttgccaataagaaaacgaattgcc
gaaaggctcaaagaatcgcaaaacacgtgcgcgttgctaaccacatttaacgaatgcgac
atgagcaaagtgatagtcctacgcagtgagttaaaagacatctttcaaaagaagtatgga
tgcaaattagggttcgtatccctcttcatgcatgcgtcaaccttagctctaaaaaaaatg
ccacaagtaaatgcatacatagataacgatgagattgtgtaccgaaattatgttgacata
tccgtagcagtggccacacccaacggattaacagttcctatcattcgagattgccaaaat
aaaaaactatcagaacttgaactggctctatccgagttggctaccaaagcgaggaacaac
aaattgtcgttagacgatttcacgggtggtacttttaccatttcgaatggaggcgttttt
ggcagcatgttaagcacacccattgtgaacatgccgcagtcggctatactaggtatgcac
acaataaaagacagagccgtagtggtaaacaatgaaattgtcattaggcctatcatgtat
ttggccctaacttatgaccacagattgctcgatggaagagacgccgtgcagtttttaagc
gcaataaaggactatatagaaaacccgagcctcatgctgattgattga

DBGET integrated database retrieval system