KEGG   Pectobacterium parmentieri WPP163: Pecwa_0533
Entry
Pecwa_0533        CDS       T01106                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pecwa_0533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pwa02044]
    Pecwa_0533
Secretion system [BR:pwa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pecwa_0533
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACX86362
Position
complement(570784..571158)
AA seq 124 aa
MRQCPQSNSETFWAMNYKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQE
HFFSTVLTDATIVDVNCQMPHCQDPAKLDYTQLIEVSLAYRKIDWEHTVAGTSGSDDWRA
PVEA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcggcaatgcccccagagcaacagcgaaacgttctgggcgatgaactacaaaccgttc
aagttcaccgtcgcgctgaacaaagcggtgccgctgatgtacaacgccctcgcctccggc
gaaatgctgccaaccgtcaccctgaagtggtatcgcacctcggtagaaggaaaacaggag
cacttcttctctaccgtgctgaccgatgccaccatcgttgacgttaactgccagatgcca
cactgccaggacccggccaagctggactacacccaactgattgaagtctcgctggcctac
cgcaaaatcgactgggagcacaccgtcgccggcacctccggctctgacgactggcgcgcg
ccggtcgaagcctaa

DBGET integrated database retrieval system