KEGG   Pectobacterium parmentieri WPP163: Pecwa_0641
Entry
Pecwa_0641        CDS       T01106                                 
Name
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: Glrx-like YAcAr
Other DBs
NCBI-ProteinID: ACX86465
Position
681380..682087
AA seq 235 aa
MKKCSIAILSLFFVYSLSNAALPGPVQQKELQQRDIQITETEQEAQRWGLSRSEWEKYQQ
LKQGKRGIQSPGLDPLTTLGIESDSSAERRRMAELWVKEEYQRTEKELAFQREVNAAWNR
LYPNALSVNMGNAAGIAHDTDGRLALFVRDNCTRCDTRLAAVLADNREVDIYLVGSDGKD
ETVRQWAVSHSIPVERVRNRQITLNHDQGLWARYGQGQMPVILQQGENGWQIAAF
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaaaaatgtagcattgctattttgagtttattttttgtttattctctttctaatgcg
gcccttccagggccagtgcaacaaaaagaactgcaacagcgtgatattcagatcacagaa
acagagcaggaggcccagcggtgggggctgagccgttctgaatgggaaaaataccagcaa
ctcaagcaaggtaagcgtggaatacaatcccctggtttggatccgctgacgaccctgggg
atagaaagcgacagttcagcggaacgacgtcgtatggctgagctttgggttaaagaagag
tatcaacgtacggaaaaagaactggcttttcagcgtgaagtgaatgctgcctggaaccgc
ctgtaccctaatgctctctctgtaaacatgggtaacgctgccggcatcgctcatgatact
gatggtcggctggcgttatttgttcgcgataactgtactcgttgcgatacccgattagcg
gctgttctggctgataaccgagaggtagatatttatttggttgggagtgacggaaaagac
gaaacagtccgacagtgggcagtcagccatagtattcctgttgagagagtcagaaaccgg
cagataacgctcaatcatgatcagggattgtgggcgcgttatggtcaaggtcaaatgcca
gtcatcctgcaacaaggggaaaatggatggcaaatcgcagcattttaa

DBGET integrated database retrieval system