KEGG   Pectobacterium parmentieri WPP163: Pecwa_0642
Entry
Pecwa_0642        CDS       T01106                                 
Name
(GenBank) Lytic transglycosylase catalytic
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: ACX86466
Position
682066..682716
AA seq 216 aa
MANRSILISMLIVLGIMHSGIVSAQKRPVALQQIPAAYRQIAKDARVPAESLYSLALTES
SRRLPYGERPWPWSINVAGKTYRYETRELAWQALRQFIRQTPLKNIDVGIAQVNLGWNGH
RFRSFYDAFEPFTNLRVAARILRECYDAKPDSWLRAAGCYHRPAGGLPTERYMAIVRQKL
KLISPVQEPLESSPPILLASSEAIIPSYQLTWIEPE
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcaaatcgcagcattttaatcagtatgctcatcgtacttgggataatgcatagcggt
attgttagcgcacaaaaacgtcctgttgccttgcaacaaatcccagcggcataccgacaa
attgctaaagatgcgcgtgtgccagctgagtcactttattcacttgcactaacggaaagc
tctcgtcgattgccttacggtgagcggccatggccgtggtcgatcaatgttgccggaaaa
acgtatcggtatgagacacgcgaattggcatggcaggcgttacgccagtttattcgccag
acaccgctaaagaacattgatgttgggatcgctcaggttaatttgggctggaacggacat
cgttttcgctctttttatgacgcatttgagccgtttaccaatttacgtgttgctgcccga
atcttacgtgagtgctatgacgcaaaacctgatagttggttacgtgccgcagggtgttat
caccgtcctgccggcggcctgccaactgaaaggtatatggcgattgtgcgccaaaagctg
aagcttatttctccagttcaggaaccattagagtcatcaccgcccatcctacttgcctct
tccgaagcaattattcccagctaccaattaacatggatagagccagaatga

DBGET integrated database retrieval system