KEGG   Pectobacterium parmentieri WPP163: Pecwa_0643
Entry
Pecwa_0643        CDS       T01106                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: ACX86467
Position
682713..683264
AA seq 183 aa
MNTLRPFLLFILSIISSGIFLLPSFASAELTVVADLGGESTEPYFEAINAQTDPNFSGST
LPQELSSPATGSGLTIASVLPVTTPELTPGKVSPRALRLTGMPPIFIIGDDPLSRDWVVK
RAGELQRLKATGFVVSVSTEASLRELQVLLPENDIAPVSGSDLAKRLQLSHYPVLITETG
LSQ
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaatacgttacgccccttcttattattcatattgtcgattatttcctcgggtattttc
ttattgccatctttcgcttcagcggaacttactgttgtagccgatcttggtggggaatct
actgaaccctattttgaagcgattaacgcacaaacggatccgaatttttccggctccaca
ctgcctcaagaattatcctctcctgccaccggttctggtctgacaatagcctccgttctt
cccgtcactacacccgaacttactccagggaaggtttcaccaagagcgttaagactcact
ggtatgccaccaattttcattattggtgatgatcctctatctcgggattgggttgtgaaa
cgggcaggggaactgcagcgtctgaaggccactgggtttgtggtcagtgtttctacagaa
gcgtctctgcgtgaactacaggttttattgcctgaaaacgatattgcccccgtatcagga
agtgacctggcgaagcgtttacagctatcccactaccccgtgctgataactgaaaccgga
ttgtcacaataa

DBGET integrated database retrieval system