KEGG   Pectobacterium parmentieri WPP163: Pecwa_0646
Entry
Pecwa_0646        CDS       T01106                                 

Definition
(GenBank) putative inner membrane protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF4400 Sigma_reg_N
Other DBs
NCBI-ProteinID: ACX86470
Position
685919..686671
AA seq 250 aa
MAEQPQSSPQRQEPPKKPGLFQTLLWVWPLKVIGILLVSLLVSLLIEYIGMLFFWTNEGA
EHSRQVMLTESGYLAEGFTQSLLMSEPVTLISGIVHQSYQWLFVDSGFISWLHQAKQMKP
KDGAAQMFNWVGSWLALALWEYLQATVYVTVIFAIRVGILVLSIPLFIMVAVTGIVDGLV
RRDLRRYGAGYESSFIYHHAKRFVKPAMYGPCMLYLSWPTAVWPNLLLLPAAVLLGIVLS
IVTGAFKKYL
NT seq 753 nt   +upstreamnt  +downstreamnt
atggcagagcagccccagtcatctccacagcgtcaggagccgcctaaaaagccgggtttg
tttcaaacgctattatgggtttggccactgaaagtgattggcattctgctggtttctttg
ttggttagtttgcttattgaatatatcggcatgctgtttttttggactaatgaaggcgca
gaacacagtcgccaggtgatgttgacggaaagtggttatctggctgaagggtttacccaa
agcttattgatgtcagaaccggttaccctcataagcggcattgttcaccaatcctatcag
tggctgtttgtggacagcggttttatcagttggctgcatcaggcaaaacagatgaagccg
aaggatggggcggcgcaaatgtttaattgggttgggagttggctggctcttgcgttgtgg
gaatacttacaggcgacggtttatgtcacggtcatttttgcgatacgggttggcattctg
gtgctatcgataccgctttttatcatggttgcggtgacagggatcgttgatggtctagtt
cgtcgggacttacggcgctacggtgctgggtacgaatccagttttatctatcatcatgcg
aagcggtttgtgaagcctgctatgtatggcccttgtatgctgtatttgtcctggccaact
gcggtgtggcctaatctgttactcttacccgctgcggttttgttgggtattgtgctgtcg
atcgttactggtgcttttaagaagtatctataa

DBGET integrated database retrieval system