KEGG   Pectobacterium parmentieri WPP163: Pecwa_0650
Entry
Pecwa_0650        CDS       T01106                                 

Definition
(GenBank) YD repeat protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: RHS_repeat PAAR_motif AHH DUF4595 RHS
Other DBs
NCBI-ProteinID: ACX86474
Position
689957..694225
AA seq 1422 aa
MRDDILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPGKPIKHSSFLGALLGAVAGAL
VAAAVAAVAVALVGVTGGLAIALVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGKVDSG
SPNVSVEGSPVSRAEVDVVLCTKHNGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKDG
AATVFFGSGQATVLEIQDEFSGWQKALLIAVEFLVPPTRGLFRGLGKLFFRGPKAVMKGL
GAGALWAGKRFTQKTRCATRAFKANKGRARVTQAAKAFKKDPVYIASGEVIESRTDIELG
QTLPLLFERTYRSASSRGGLAGRGWQDSWSEVATLSDDNGDTHVTITLAQGYDIDFTFGI
GATVVYCAEYPEFKLVKRHNGFHLWHRDSQTWRAFTVRQGDRLRLSAITDNHQNRIDFLR
DPKGYLRKVRHSDGIELLLVWQGKFLRQVQRIDGGQKTVLAEYRQDEQGRLVEADAAHAY
HLFYDYDNQNRLIRWHDNDKTWARYEYDHQGRCVYTTCADGYLTANFEYLSDRVVMTDGL
GQRHEYGFNALYLMAWEKSPLGHVTRYEYDEVGNLLREISPAGRVVEFAYLDDTGLVSTF
TDGSGHAWQYAYDDHERLIGITDPLGRNWAWQYDSKGNPLSLTGPDASEVRFAWNRYGLL
TEVSDQNGQVQASLYYDHRQRLLSATDAESRTQQLRYDQQDRLTTWTRPDGSTYRLGYRR
ASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWAQTYGPFDLLTSRTDAAGRTWQ
YEYDKESQQLVCVTAPDGNQWQWWLDADARVIRERDMAGTETHYGYDEDGHSITVRNGEG
EIRHFLYDGRGLLIKETAPDDTLHYRYDAAGRLIEVASSTSHIQLAYDERDRVVLERNSG
TVIRRDYQNATREVTRTLLWDEDKDGDDTALTSIFRYRATGELHQVQLPDGAELTLAHDA
AGRESSRQSQAGFMQHREYDAMGWLTREMSGQTVDGRLQPVQTREYLYDGAGNLTGTRRN
REAAGYQLDASGRVLSVLSGGAGRTVETEEQYRYTRSGLPQDATRLTEWQAGRLTQQDNT
HYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPAGERWFYRYDPFGRRIGKR
CEQTQDELRYLWDSDQIADVRHHRNNQLISRRHWVHNGWELLVQQRQNTDGSWETDFVTS
GHNGEPQAIFNKQGDLRWQAPRTNLWGQRYTDNTESLDPGLAFAGQYRDVESSLCYNRFR
YYDPSGGCYISPDPISILGGENNYGYVQNPLDWVDPFGLTSCELAKKMENAGTPRPVNSA
AHHIVGETSKGAKPARDILNKHKIDINGSDNGVFLPNRNNTDGLAGILHNGRHPDDYLAA
VNRRIELADILGGKSEVVKELGRIRDILSSANRNASWSTVLL
NT seq 4269 nt   +upstreamnt  +downstreamnt
atgcgtgatgacattctggcgcgtattgcgcgtgtcggtgccatgcacgcgggcaaccgg
cccacgttaccgcctgatttaccggcacccggcagcggctcgccgccgacctcaccgggt
aaacccatcaaacacagcagtttcctgggggcactgctcggtgccgtggctggggctctg
gtagcagcagcggtcgcggccgtggccgttgccctggtgggcgtcaccggtggactggcg
attgcactggtcggtgggctggcggtactgggagcgggaagcctgatatcggcggtcagt
ggtcgggtatccgccatggtggacagtgcctcaccgccggcggggaaagtggacagtggt
tcaccgaatgtgtcggtggaagggagtccggtttcccgtgccgaagtcgatgtcgttctc
tgcaccaaacacaacggtccgcaactgattgcgcagggcagtgaaactgtcttcgtgaac
ggtcatccggcggcgcggataggcgataaaaccgtgtgtggtgccactatcaaggacggg
gcagcaacggtgttctttggttccggtcaggctaccgtactggagatacaggatgaattc
agcggctggcaaaaagcgctgctgattgcggtggaatttctggtgccgccgacccgtggc
ctgtttcgcgggttggggaagttattctttcgcggccccaaagcggtgatgaaagggctg
ggggctggcgcactctgggcaggaaaacggtttacgcaaaagacccgctgcgccacccgc
gcctttaaggcgaacaagggtcgggcacgggtgacgcaagcggccaaagccttcaagaaa
gacccggtgtatatcgccagcggtgaagtaattgaaagccgcaccgatatcgagctgggc
cagactctcccgctgctgttcgagcgtacctatcgctccgcttcttcacggggcggatta
gcaggccgtggctggcaggatagctggagcgaagtcgcgaccctcagcgacgataacggc
gacacccatgtcactatcactctggcgcagggttatgacattgatttcaccttcgggata
ggggccaccgtggtgtactgcgccgagtaccccgaattcaaactggtgaaacgccataat
ggctttcacctgtggcaccgcgacagccagacctggcgggcctttaccgtcagacagggt
gaccggctacggctgtctgccattaccgacaaccaccagaaccgtatcgactttctccgt
gaccccaaaggctacctgcgtaaggtgcggcacagcgacggcatcgagctgctgctggtg
tggcaggggaagtttctgcgtcaggtacagcgcattgatggcggtcagaaaaccgtactg
gccgaataccggcaggatgaacaaggccgactggtcgaggcggatgcggcccatgcctat
cacctgttttatgactacgacaatcaaaaccgcctcattcgctggcacgacaacgacaaa
acctgggcacggtatgagtatgaccatcagggccggtgcgtttacaccacctgtgccgac
ggctacctgacggcgaatttcgagtacctgtccgaccgcgtggtgatgaccgacgggctg
ggtcagcgccatgaatacggcttcaatgccctgtacctgatggcctgggagaaatccccg
ctcggccatgtcacccgttatgaatacgatgaggtcggcaacctgctgcgggaaatctct
ccggcagggcgagtcgtagaatttgcctatctggatgataccggactggtcagcaccttc
accgacggcagcggccacgcgtggcagtacgcctatgacgaccatgaacggcttatcggt
attaccgacccgctcgggcgtaactgggcctggcagtacgacagcaagggcaatccgttg
agcctgaccgggccggacgccagtgaagtccggtttgcgtggaaccgctacggcctgctg
accgaagtcagcgaccagaacggccaggtacaggccagcctgtattacgaccatcgccag
cgcctgttaagtgccaccgatgcggagtcccgcacccagcaactgcgctacgaccagcag
gaccggctgaccacctggacacgcccggatggctccacttatcggctgggctatcgccgt
gcaagctggaagctgccggagcagctgctgcgccccgacgacaaacaagagcagcgccag
tacgacaagcacaacaacctgctgaactataccgacggcaacggcgcagtatgggcacaa
acctacggcccgtttgacttgttaacctcccgtaccgatgcggcaggccgtacctggcag
tacgagtatgacaaagaaagtcagcaactggtgtgcgtcacggcaccggacggtaaccag
tggcaatggtggctggatgcggatgcgcgggttatccgcgaacgggacatggcgggtacg
gagacccactacggctatgacgaagacggccactccatcactgttcgtaacggcgaaggg
gaaatccgccacttcctgtacgacgggcgtggattactgataaaagaaaccgcgccggac
gataccttgcactaccgctacgatgcggcaggcaggctgatcgaagtggcatcctccacc
agtcatatccagctggcgtatgacgagcgtgaccgtgtggtacttgagcggaacagtggc
acagtcatccgccgtgattatcagaacgctacacgtgaggtcacccgtaccctgctttgg
gatgaggataaggacggcgacgacacggcactcaccagcattttccgctaccgcgccaca
ggtgaactgcatcaggtgcagttaccggatggcgcggaactgacgctggctcacgatgct
gcggggcgtgagtcttcccgccaaagtcaggcgggctttatgcagcaccgtgaatacgac
gccatgggctggctgacgcgggaaatgagcggccagacggtggacggtcgcctgcagcct
gtgcagacccgtgaatacctctacgacggcgcaggcaacctgaccggcactcggcgcaat
cgcgaagcggcaggctatcaactcgatgccagcggacgggtactgtcagtactgagcggc
ggcgcggggcgcaccgtcgaaaccgaagagcaataccgctatacccgcagcggtttgccg
caggatgcgacaaggctgaccgaatggcaggccggacgcctgactcagcaggacaacact
cactatcaatatgacaaggccgggcggctcattcgcaaacaggtggtgcagccgggctat
cggccgcaggtgtggcactaccgttgggacagtcgcaaccagctccgagtggtggatacg
ccagcaggtgaacgctggttctaccgctacgacccgttcggacggcgcatcggcaagcgc
tgtgagcaaacgcaggatgaactccgctacctgtgggatagcgaccagattgccgacgtg
cgtcaccaccgcaacaaccagcttatcagccgccgccactgggtacataacggctgggag
ctgctggtacagcaacgccaaaatacagacggcagttgggaaacggactttgtgaccagc
ggccataacggcgaaccgcaggccatatttaacaagcaaggtgatctgcgctggcaggct
ccacgcaccaatttatgggggcagcgctatacagataatactgaaagtcttgatccagga
ctggcctttgccgggcaataccgtgacgttgaaagcagcctatgctataacagattccgc
tattatgatccgagtggtggttgttatatctcgccagacccgatcagtattttgggtggt
gagaataactatggatatgtgcagaatccgctggattgggttgatccgtttgggttaact
agttgtgaactagcgaaaaaaatggagaatgcggggacacctaggccagtgaattcggcg
gcacaccatattgtaggcgaaacgtctaaaggcgctaagcctgctagggatatattgaat
aaacataaaatagatataaatggctctgataatggagtctttctgccaaatagaaataat
acagatgggctagcagggatactacataatggtaggcatccagacgactatctagctgcg
gtaaatagaaggattgagttggctgatattttaggtgggaagtcagaggtcgttaaagag
ttgggtaggattagagatattctttcttctgctaatagaaatgcaagctggagtacagta
ttgttatga

DBGET integrated database retrieval system