KEGG   Pectobacterium parmentieri WPP163: Pecwa_0652
Entry
Pecwa_0652        CDS       T01106                                 
Name
(GenBank) Protein of unknown function, RAQPRD
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: Plasmid_RAQPRD Tox-REase-3
Other DBs
NCBI-ProteinID: ACX86476
Position
694946..695254
AA seq 102 aa
MCRFIGLSVLLASVCVVQAHASEKDELALVMRQLDQVQAGLDRARVVANQNGQDARFYFD
YGSASRDISAMRKGIEQYLEPSRAQPSVPLSVSGQYRQERGQ
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtgccgatttattggactgagtgtactgctggcttcggtttgcgtagttcaggcccat
gcttccgaaaaagacgaacttgctctggttatgcgtcaacttgaccaggttcaggctgga
ttagatcgtgctcgagtagttgccaatcagaatggtcaggatgcgcgcttttattttgac
tacggcagtgcttcccgagacatatccgctatgcggaagggtattgagcaataccttgag
ccctctcgtgcccaaccttcggtaccgctttccgttagtgggcaataccgccaggagaga
gggcaatga

DBGET integrated database retrieval system