KEGG   Pectobacterium parmentieri WPP163: Pecwa_0656
Entry
Pecwa_0656        CDS       T01106                                 
Name
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACX86480
Position
696258..696917
AA seq 219 aa
MSRFRNAVSARDNHIFTLRAIVVGLFLLLIFTASGWMMAPSKLTIHNPPDLRSGSTREWW
RVPPSTVYSFAFYIFQQLNAWPKNGEVDYPAKIAQLSPYLTPACQDFLNKDARFRTDNSE
LRDRVRVVYEIPKRGYSSKSVDVLSDDDWIARLDLVADEYYHTEPVKRAMVRYPLRVIRW
EGDPERNQFGLALDCYASTPQRLEAMPVIAPEKKSGVFQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagccgctttcgtaacgctgtcagtgctcgcgacaatcatatttttaccttgcgggcc
atcgttgttggcctgtttttattgcttattttcacggcttcgggctggatgatggcgcca
agtaaactgacgatccacaatcctccggacctgcgttctggtagcacgcgcgagtggtgg
cgagttccaccctcaacggtatacagttttgccttctatatttttcagcaactcaatgcc
tggccaaaaaacggtgaagtggattatcccgcgaaaatcgcgcagttaagtccttatctg
acacctgcatgccaggatttcctgaacaaagatgctcgatttcgcactgacaatagcgag
ctgcgtgatcgcgttcgtgttgtgtatgagatccccaaacgcggttatagcagtaaaagc
gtcgatgttttgtctgatgatgactggattgcccgtctggatttggtcgctgacgagtat
taccacactgaacccgtaaaacgggcaatggtgcgttatccattgagagtcatccgctgg
gaaggtgatccagaacgtaaccaatttgggttggctctcgattgctatgccagcacgcct
caacgactggaagcgatgccggttattgctcctgagaaaaaatcgggggtattccagtga

DBGET integrated database retrieval system