KEGG   Pectobacterium parmentieri WPP163: Pecwa_0658
Entry
Pecwa_0658        CDS       T01106                                 
Name
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: TrbI DUF2205 ZapB Mod_r UPF0242 Seryl_tRNA_N Sec34 YabA ERM_helical DUF724 bZIP_1 Ax_dynein_light HAUS-augmin3
Other DBs
NCBI-ProteinID: ACX86482
Position
697807..699348
AA seq 513 aa
MKMQSNMLVKLAVPLTLLVTVFIGLKACSPDKAQQQPDTTAKNDAILNDVTPEQLRALGI
EGDTPEDTLRTLIGRLNTVTTKQDRLDAENKTLAEENKRLKQTNQNVDERIGQAIANAKT
EESSEKSQLKSQVQSLSSTVSDLVQQLKEVGTPGSTSSAPSGNHVGPGSDIPIGLGLDGD
FTGQVTPSGSSGTDGLRWVEPIDAVAVDASGKPVTEGSSNRAAGFTFATSFLEENPVTRQ
QAELARQAGNGQTLSGNNASEGPVEPVYTLPENSTLIGSRAMTALLGRVPVDGKVTDPYP
FKILIGKDNLTANGIDLPDVQGAIVSGTATGDWTLSCVRGSVSSITFVFSDGTVRTLPRP
SGQTEGNNSQNSNNGGSIGWISDENGIPCLSGERKSNASTYLPTLFALSASSAAGEALAQ
NQNTTQGNGFGGVTSSLTGDAGQAVMGKAISGGMQETVDWVKARYGQTFDAVYVPPGMKV
AVHITRQLAIDYEEKGRKVKYDFNLGQSGTGMD
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaaaatgcagtcaaatatgctcgttaaactggcagtaccgctaacgttgctggtgacg
gtttttattggtttgaaggcatgttctcccgacaaggcgcaacaacaaccagatactacg
gcaaaaaatgatgccatcctgaacgatgttacccccgaacagttaagggcgctggggatt
gaaggcgacacgcctgaggatacgctacgtacgttgattggtcgtttgaatacggtcaca
accaagcaagatcgattggatgcagaaaataagacgctggctgaggaaaacaagcgtctg
aaacaaaccaatcaaaacgttgatgaacgtattggtcaggcgattgcgaatgcaaaaacg
gaagagagtagtgagaaaagccaactgaaatctcaggtgcaatcgttaagctctactgtc
agcgatctcgtgcaacaacttaaagaggtcggaacgcctggctcgacgtcgtcagcgcct
tctggcaatcatgtcgggccggggagtgatatcccgatagggttggggttggatggcgat
tttaccggacaggttacaccatctggttcatccggtactgatgggttgcgctgggttgaa
ccaatagatgctgttgcggtagatgccagtggtaaacctgtgacagagggaagcagtaac
agagcggcgggttttacctttgctacttcttttctggaagaaaatccggtcacccggcag
caagccgaactggccagacaagcagggaatggccaaacgttaagtgggaataatgcctct
gagggtcctgtcgagcctgtctataccttgcccgaaaattcaacgttgattggcagtcgt
gccatgacagccctgttggggcgagtgcctgtcgatgggaaagtgacagatccgtatcca
ttcaaaattctcattggcaaagacaatctgactgcaaacgggatcgatctgcctgatgtc
cagggggcgattgtgtccgggacagcgacaggggactggacgttgtcatgtgtccgcggt
tcggtatccagtatcacgttcgtctttagcgacggaacggtgcgtacgttaccgcggcca
tctggtcagacagaaggtaacaatagccagaacagtaataacgggggaagtattggctgg
atttcggatgaaaacggtattccgtgtctttccggtgaacgtaaatctaacgcatcgacc
tatctacctacgctatttgctctatcggcaagttctgcggcgggtgaggcattggcacag
aatcaaaataccacacaagggaacgggtttggcggtgtgacgtcttcactgaccggtgat
gccggacaggccgtaatggggaaggcgatttcaggcgggatgcaggaaaccgttgactgg
gttaaggcgcgttatggccagacgtttgatgctgtttatgtccccccgggcatgaaagtc
gcggttcatattacccgtcagctggcgatcgactatgaagagaaagggcggaaagtgaaa
tatgacttcaatcttggccaatctggcactgggatggattaa

DBGET integrated database retrieval system