KEGG   Pectobacterium parmentieri WPP163: Pecwa_0661
Entry
Pecwa_0661        CDS       T01106                                 
Name
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Other DBs
NCBI-ProteinID: ACX86485
Position
700595..701005
AA seq 136 aa
MNNKAQCAIASLFFAVTLSGCSTSKEQMLPPGDSTMLELWNGGASTTQDRHEGRTTLRRT
LTDTDQANVLREAEHYSRTQENEIQQTFPRLPNPDLVMYVYPHLSKGNTPVPGYSTVFPF
YSQVQYALPGERTEAF
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaataataaagctcaatgcgcgatagcctcgctttttttcgccgtaacactttcagga
tgcagtaccagcaaagagcagatgctgcctccgggcgatagcaccatgctagaactgtgg
aacggtggtgcgtcaacgactcaagacaggcatgaagggcgcactacactgcggcgcacc
ctgacggatactgaccaggcgaatgtgttgcgggaggcggaacactatagccgcacccag
gagaatgagatccagcagacgtttcctcgtctgccgaatcctgacctggtcatgtatgtc
tatccccatctcagtaagggtaatactccggtgccggggtatagcacggtattcccgttc
tacagccaggtgcaatatgccctgccgggtgaacggacggaggcattttaa

DBGET integrated database retrieval system