KEGG   Pectobacterium parmentieri WPP163: Pecwa_0662
Entry
Pecwa_0662        CDS       T01106                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG ResIII DUF87 FtsK_SpoIIIE T2SSE AAA_22 TrwB_AAD_bind AIG1 AAA_29 AAA_16 AAA_7
Other DBs
NCBI-ProteinID: ACX86486
Position
701005..703830
AA seq 941 aa
MFSLFQRRTTSSDENLKGNGPFAVNGHEPLSRDGRLTERDEQQLYGVAPSIIDYMPWAEY
LSADQCLLLDDGVSVGAVYEIIPVGTEGRPAERLEEIRDVVEDALQDSLPELDSHQWVVQ
LYCQDDTDVTAYMDKLRGYVKPWAEGAAFTQAWLAETDRHMKSISAEKGLFDDKIVTGAP
WRGQTRRTRMVIYRYVEKQSRDPLPPATMLNQVCDRLTSALSGAGIRCHRQNGEQIHNWL
LRWFNPKPEWVAPELLYRTASHDDGAPDSLPILNDFSETLWFTRPRSDAERGVWWFDNVA
HKAVPVERLRKAPQTGHLTGEVRRGENINTLMDLMPQGTVIAMTLVVQPQDVLEEEFASL
GKNAMGENVESQRVRADAATAKEYLGERHKLYRSSLTFLIKASDLDTLDKRYLDISAKLL
NAGLQPINPEHDVAPLNGYLRALPMCFNPETDQNHWYTRLTFVQHFACLLPVFGRDTGTG
NPGLSFFNRGGAALSFDPMNKADRTQNAHLLLFGPTGSGKSATLCSVLAQVMAIHRSRLF
LLEAGNSFGLLGDYYESLGLTVNKISIKPGRGVSLAPFADAHLLLQVDPRELITDELSLP
ELDDDAKEPDDDDEEKRDILGEMEIAARLMVTGGEAAEEARMTRADRGMLREAILAAAKQ
SYEAGHQMLPSDLMSALEHIARDNTKDSEGRDRRTAARRARAEEMAEALRMFTEGFEGEL
FNRPGTPWPEADVTIIDLGTLAREGYEAQMAVAVIALVNTVNNIAERDQYLDREINMVID
EAHIATTNPLLSPYMTKVVKMWRKLGAWLWLATQNLADYPDTSEKMLNMAEWWLCLTMPP
DEVEQISRFKKLNEEQKAMLLSATKLPRCYTEGVVLAKRVEALFRAVPPSLYLALGMTEK
EEKAERRQLMNEHGCSELQAAFLVAKKLDKARGIMTETEAA
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgttttcactgtttcagcgtagaacgacatcttcagatgaaaatctgaaagggaatggg
ccatttgcggtaaatggccatgaaccgcttagccgtgatgggcgattaactgagagggat
gaacaacaactttatggcgttgcgccttccattattgactatatgccctgggcggaatat
ctctcagcggatcaatgcctgctgttggatgatggtgtctccgttggtgcggtctatgaa
atcatacccgtaggcacggaggggcgaccagctgagcgcctggaagagatccgcgatgtg
gttgaagatgccttgcaggatagcttgcctgagttggatagtcaccagtgggtcgtgcag
ctttactgccaggatgatacggatgtgacggcgtatatggataagttacgtggttatgtc
aaaccctgggcggagggggcggcattcacacaggcctggctggctgaaaccgatcgccat
atgaaaagcatttcggcagagaaaggcctgtttgacgataaaattgtcacgggtgcaccc
tggcgcggacaaacccgccgcacacgtatggtgatttaccgctatgttgaaaagcagtcc
cgcgatccgttaccgccggcgaccatgctgaaccaggtctgcgaccgtttaacctcagca
ttgtccggcgccggtattcgttgccatcggcaaaatggtgaacagatacataactggctg
ctacgctggtttaaccctaagccggaatgggttgcgcccgaactgctgtaccgtacagcg
tcacatgacgacggcgcacccgattctcttcctatattgaacgattttagcgaaacattg
tggtttacgcggccgcgcagcgatgccgaacgtggagtatggtggtttgataatgtggcg
cacaaagcagtacccgtagaacggctgagaaaagcaccacagacggggcacttgaccggt
gaagtcaggcgtggagagaacatcaatacgctgatggatctgatgccgcagggaacggtt
attgcgatgacattggttgttcaacctcaggatgttttagaagaggagttcgccagcctg
ggtaaaaatgcaatgggcgaaaatgttgaatctcagcgtgtacgcgcagatgcggcaaca
gccaaagagtatctgggtgagcggcacaaactgtatcgctcatcgttgacgtttctgatc
aaagcgtcagatctggatacgctcgacaaacgctatctcgatattagtgccaagctgctc
aatgccggccttcagccgatcaaccctgaacatgatgttgcgccactcaatggctatctg
cgtgctttaccgatgtgtttcaaccctgaaacggatcaaaaccactggtatacccggctg
acgtttgtacagcactttgcctgcctgctgccagtttttggccgtgatacgggaacgggt
aatcccggcctttcctttttcaatcgcggaggggcggcattgtcattcgatccaatgaat
aaggcagacaggacacagaatgcccatttactgttgtttggaccgacaggttcgggtaag
tcagcgacattgtgtagtgttttagcgcaggtgatggctatccaccgttcacggctgttt
ttactggaggcgggaaactcgtttgggttgcttggcgattactatgagtcattagggttg
acggtgaacaagatcagcatcaaacctgggcgtggtgtctcactggcaccgtttgccgat
gctcacctgttgttacaggtagatcccagagaactcattactgatgagttgtctttgcct
gagctggatgatgatgcaaaagagccggatgatgacgatgaggaaaagcgcgatattctg
ggagaaatggagatagctgcacgtcttatggtcacggggggagaggcagcagaagaagcc
agaatgacgcgtgccgatcggggcatgttgcgtgaggctattctggctgcggcgaaacaa
tcgtatgaagctggacaccaaatgttgccctcggatttgatgtctgcgttggagcatatc
gcccgagataacaccaaggacagtgaggggcgagaccgccgaacggcagcacggcgtgcg
cgtgctgaggagatggctgaggcgttgcgcatgtttaccgaagggtttgagggagaactg
tttaaccgcccaggaacgccctggccagaagcggatgtcactatcatcgatctcggtaca
ttggcgcgtgagggctatgaagcacagatggccgtcgctgttatcgccctggtgaatacc
gtcaataacatcgctgaacgtgatcagtacctggatcgtgaaatcaatatggtgatcgat
gaagcccatattgcgacgacgaaccccctgctatcaccgtatatgactaaggtggtgaaa
atgtggcgtaaattgggggcgtggctctggcttgcaacacagaacctggcggattatccg
gatacatcggaaaaaatgctcaatatggcagaatggtggttgtgtctgaccatgccaccg
gatgaagtggagcaaatctcgcggttcaaaaagctgaatgaagagcaaaaggcgatgttg
ctctctgcgacaaagttaccccgatgctatacggaaggtgtggttctggctaaacgggta
gaagccttattcagggccgttcctcccagcctttaccttgcgttggggatgactgaaaaa
gaagaaaaagcggaacgccggcaactgatgaacgaacatggctgcagtgagctgcaagcg
gcttttctcgtggcgaagaagctggataaggcaagagggattatgaccgaaacggaggct
gcgtga

DBGET integrated database retrieval system