KEGG   Pectobacterium parmentieri WPP163: Pecwa_0802Help
Entry
Pecwa_0802        CDS       T01106                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00790  Folate biosynthesis
pwa01100  Metabolic pathways
Module
pwa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pecwa_0802
Enzymes [BR:pwa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pecwa_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACX86621
UniProt: D0KHL9
Position
849437..850270
Genome map
AA seq 277 aa AA seqDB search
MQLVARDSTLDLSCPHVMGILNVTPDSFSDGGKHNNLDAALLHVQNMMSAGATLIDIGGE
STRPGAAEVSTEEELERVVPVVEAIAKRFDVWISVDTSKPEVMTASALAGAHLINDIRAL
QEPGALEAAAATGLPVCLMHMQGMPRTMQHKPHYDDLLQDIGNFLQQQIERCVNANIPKS
KLLLDPGFGFGKNLAHNYALLARLSELHRFELPLLVGMSRKSMIGQLLNVPPAQRVHGSV
ACAVIAAMQGAQIIRVHDVKETADAMRIVEATLSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggtcgccagagactcaacgctggatctttcctgcccacacgtcatgggcatt
cttaacgttacgccggattctttttccgatggtggtaaacacaataatcttgatgcggca
ttacttcatgtccagaacatgatgagcgctggcgcgacactgatcgatattggcggtgag
tcaacgcgtcccggcgcggctgaggtcagtacggaagaagaactggaacgtgtagtgcct
gtggttgaagccattgctaaacgctttgacgtatggatctcagtcgatacctcaaagccg
gaagtgatgacagcgtcagcgttggcgggcgcgcatctgattaatgatattcgtgctttg
caagagccgggtgctctggaggcagcggcggcaacaggtttgccagtgtgcctgatgcat
atgcagggtatgccgagaaccatgcagcacaaaccgcattatgatgacctgcttcaggat
atcggaaatttcttgcaacaacagatagaacgctgtgttaatgccaatattccgaaaagt
aagctattgctggatcctgggtttggattcggtaagaatcttgctcataattacgcgctt
ctggctcgtttgagcgagttgcatcgttttgaactgcctcttttggttggcatgtcgagg
aaatccatgattggacaactccttaatgtgccgcctgcgcagcgtgttcatggcagcgtc
gcttgtgcagttatcgctgcgatgcaaggagcacagattattcgcgttcacgatgttaaa
gaaacggctgatgctatgcgcattgttgaggctaccctttctgcgaaggaataa

DBGET integrated database retrieval system