KEGG   Pectobacterium parmentieri WPP163: Pecwa_1366Help
Entry
Pecwa_1366        CDS       T01106                                 

Definition
(GenBank) acyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00473  D-Alanine metabolism
pwa01100  Metabolic pathways
pwa01503  Cationic antimicrobial peptide (CAMP) resistance
pwa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pecwa_1366
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pecwa_1366
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Pecwa_1366
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pwa01504]
    Pecwa_1366
Enzymes [BR:pwa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     Pecwa_1366
Antimicrobial resistance genes [BR:pwa01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    Pecwa_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ACX87171
Position
1492763..1492984
Genome map
AA seq 73 aa AA seqDB search
MEQEILALFEKILSRKVGFNDELIESDILDSILAVDLVLEVQDVYGCVIPPTEVATVLKT
PAELARYIEENRG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagaaatactcgcgctgtttgaaaagatcttatcccgtaaagtgggctttaat
gatgaactgattgagtccgatattctcgactctattctggcggtcgatctggtgctggaa
gtgcaggacgtttacggctgtgtgatcccgccaactgaagtcgctaccgttctgaagacc
ccagcagaattggctcgctacattgaagagaaccgcggctaa

DBGET integrated database retrieval system