KEGG   Pectobacterium parmentieri WPP163: Pecwa_1609
Entry
Pecwa_1609        CDS       T01106                                 

Definition
(GenBank) YD repeat protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: RHS_repeat PAAR_motif DUF4595 RHS
Other DBs
NCBI-ProteinID: ACX87399
Position
1744928..1749271
AA seq 1447 aa
MREEILSRIARVGAMHAGNRPKPPPDLPEPGQGKPPTSPGKAIKHSSFWGALAGAAVGAL
IAAAAFTVAAAAVAGAVALTGITGGAGLALVVGVVKLAVGFGAVFALGDLIGGVTNRVSA
MVDSASPSSGAVKDGSKTVFVEGNPVSRAEIDAVLCDKHSGPQLIAQGSATVFVEGYYAA
RVGDKTVCGATIKEGASTVFFGSGQESPLSVADEFSGWEKALILAVEFLMPPSRGLFRGL
GKLFTKGPMAVLRGMKAGAAHALEGLRSAVQCAKNGFKESKGLARVTESIRGFLKDPVYI
ASGEVIEKRLDLELGQTVPLLFERTYRSGSPHSGLLGHGWHDSWSEVATVGRTEQGDIQV
TLTLAQGYDIDFTFVVGATVVYCAEYPEFKLVKRHNGFHLWHRDSQTWRAFTAKQGDQLL
LSAITDNHRNRIDFLRDPKGYLRKIRHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYR
QDEQGRLVEADAAHAYHLFYDYDSHHRLIRWHDNDQTWARYEYDPQGRCVYTTCADGYLT
ANFEYLADRVVMIDGLGQRHEYGFNDLYLMAWEKSPLGHITHYEYDDVGNLLREISPAGR
VVEFAYLDNSGLVSTFTDGSGHQWHYDYDHYERLIGITDPLGRSWAWQYDSKGNPLSLTG
PDASEVRFAWNRYGLLTEVSDEQGRTQASLFYDHRHRLMSATDAESRTRQLRYDQQDRLT
SWTRPDGATYRLGYRRASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWAQTYGP
FDLLTSRTDAEGRTWQYEYDKESQQLVCVTAPDGNRWQWWLDADARVIRERDMAGTETHY
GYDEDGHCIAVRNGEGETRHFLYDGRGLLIKETAPDDTLHYRYDAAGRLIEVTSSTSHIQ
LEYDERDRVVQERNSGTAIRRHYQDTSHTVTRSLHWEGEEDSAALTSTFRYSATGELRQV
QLPDGAELTLAHDSAGRESSRQSQAGFMQHREYDAMGWLTREMSGQAVDGRLQPTQTREY
LYDGAGNLTGTRRNREAAGYQLDASGRVLSVLSGGAGRSVNTEEQYRYTRSGLPQDATRL
TEWQAGRLTQQDNTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPAGERW
FYRYDPFGRRIGKRCDQTHEDIRYLWDGDQIAEVRHYRDDELVSRRHWIHNGWELLVQQR
QNADGRWETDFMTSSHNGEPQAAFNLAGELRWQAPRTNLWGQRYTDNTENLDPGLAFAGQ
YRDAESSLCYNRFRYYDPNGGYYISPDPVSIFGGDVNYGYAHNPLGWVDPFGLASCEHLN
RMAKEVHDLAGGLKTPDTRAIRNSTVSIVEATVDGKKVLYAAGSGGRLNPRQVETLERLG
VSRENIFKGARVTNEFSKLENHAERIILRNLPEGAVVNRWGISWGGLQRGIPCDHCAPFV
RDAGGFF
NT seq 4344 nt   +upstreamnt  +downstreamnt
atgcgtgaggaaattctctcccgcattgcgcgggtaggggcgatgcacgcgggtaaccgt
cctaaaccgccgccggatttacctgaaccgggtcagggtaaaccgcctacctcgccgggc
aaggccatcaagcacagcagcttctggggcgcactggccggcgcggctgtcggggcgtta
attgctgctgccgcgtttaccgtggcggcagcagccgtcgcgggtgccgtggccctgacc
ggcatcaccggcggggccggtctggctctggtggtgggggtcgtcaagcttgcagtcgga
tttggtgccgtgtttgcgctgggtgacctgataggcggcgtcactaaccgggtctcggcc
atggtggacagcgcctcgccttcatcgggggcggtcaaggatggctcaaagaccgtcttt
gtcgaaggcaatccggtctcgcgcgctgaaatcgatgcggtgctgtgcgacaaacacagc
ggcccgcaactgattgcccagggcagtgccacggtatttgtcgagggctactatgcggcg
cgggtgggggacaaaaccgtctgtggagccacgatcaaggaaggcgcttcgacggtgttc
tttggttcaggccaggaatcgcctctctcggtagcggacgagttcagcggctgggaaaaa
gcgctgatactcgcggtggaattcctgatgccccctagtcgcggtctgttccggggactg
ggcaagctgtttaccaaagggccgatggcggtgctgcggggcatgaaagcgggagcagca
catgccctggaagggctccgtagcgccgtgcagtgcgcgaaaaacggctttaaagaaagc
aaaggactggcgcgtgtcaccgaatccattcgcggcttcctgaaagaccccgtctacatc
gctagtggtgaggtcattgaaaaacgcctcgatctggagctgggccagaccgttccgctg
ctattcgagcgcacctaccgctccggtagccctcactccggcctgctggggcatggctgg
cacgatagctggagtgaggtggccacagtgggtcgcaccgagcagggtgacatccaggtg
acgctcaccctggcacagggctacgacatcgacttcaccttcgtggtcggtgcgaccgtg
gtgtactgcgccgaatacccagaattcaaactggtgaaacgccataacggctttcacctg
tggcaccgcgacagccagacctggcgggcgtttaccgccaagcagggagaccagctactg
ctgtcggctatcaccgacaaccaccgcaaccgcatcgactttctgcgcgatccgaaaggc
tacctgcgcaagatcagacacagtgacggcatagaactgctgctggtgtggcagggcgag
ttcctgcgccaggtacagcgcattgacggtggccagaaaacggtgctggccgaataccgg
caggatgaacagggacggcttgtcgaggccgacgccgcccatgcctaccacctgttctac
gactacgacagccatcaccgtctgatccgctggcacgacaacgaccagacctgggcacgg
tatgaatacgaccctcaggggcgctgcgtttataccacctgtgccgatggctacctgacg
gctaattttgagtacctggccgaccgcgtggtgatgattgacgggctggggcaacgccat
gaatacggcttcaacgacctgtacctgatggcctgggagaaatccccgcttggccatatc
acccattacgaatacgacgacgtaggcaacctgctgcgggaaatctctccggcagggcgg
gtcgtggaatttgcctatctggacaacagcggactggtcagcacctttaccgacggcagc
ggccatcagtggcactacgactatgaccactacgagcggctgatcggcatcaccgaccca
ttaggtcgcagttgggcatggcagtacgacagcaagggcaatccgctgagcctgaccggg
ccggacgccagcgaagtccggtttgcgtggaatcgctacggcctgctgaccgaggtgagt
gatgaacaaggccggacgcaggccagcctgttttatgaccaccggcaccgcctgatgagt
gccactgatgcggaatcccgcacccggcaactgcgctatgaccagcaagaccgccttaca
agctggacacgcccggatggtgccacctatcgcctagggtatcgccgtgccagttggaaa
ctgccggaacaactgctgcgcccggacgataagcaagagcaacgccagtacgacaaacac
aacaacctgctgaactacaccgacggtaacggcgcggtatgggcacaaacctacggcccg
ttcgacctgctgacttcacgcaccgacgctgaaggccgtacctggcagtacgaatatgat
aaagaaagccagcaactggtgtgcgtcaccgcaccggatggcaaccgctggcaatggtgg
ttggatgccgatgcacgggttatccgtgagcgggacatggcggggacggaaacccattac
ggctacgatgaggacggacattgcatcgcggttcgtaacggcgaaggagaaacccgccac
tttctgtacgacgggcgcggcctgcttatcaaagaaaccgcgccggacgacaccctgcac
taccgctacgatgcggcaggcaggctgatcgaagtgacatcctccaccagtcatatccag
cttgaatatgacgagcgtgaccgggtggtacaggagcggaacagcggcacggcaatccga
cgccactatcaggacacgtcgcataccgtcacccgcagcctgcactgggagggcgaagaa
gacagtgcggcactcaccagcaccttccgttacagtgcgacaggtgaactgcgtcaggtg
cagttaccggatggcgcggagctgacgctggcgcacgacagtgcgggtcgggagtcttcc
cggcagagtcaggctggctttatgcagcaccgtgaatacgatgccatgggctggctgacg
cgggagatgagcggccaggcggtggacggtcgcctgcaaccgacccagacgcgggaatac
ctctacgacggcgcaggcaacctgaccggcacccgacgcaaccgtgaagcagcaggctat
caactcgatgccagcggacgggtgctgtcggtactgagcggcggtgcggggcgcagcgta
aacaccgaagaacaataccgctacacccgtagcggcttaccacaggacgcgacccgcctg
accgaatggcaggccggacgcctgacccagcaggacaacactcactatcagtatgacaag
gccggacgtctcatccgcaagcaggtggtgcagccgggctatcggccgcaggtgtggcac
taccgttgggacagccgcaaccagctcagggttgtggatacgccagcaggtgaacgctgg
ttctaccgttacgacccgttcggacggcgcattggcaaacgttgcgaccaaacccatgaa
gacatccgctatctatgggatggggaccagatagccgaagtacggcactatcgtgacgat
gaattggtatcgcgtcggcactggatacacaacggctgggaactgctggtacagcaacgg
cagaacgccgatggtcgttgggaaaccgattttatgactagcagccataatggtgaaccg
caggcagcttttaatctggctggtgagcttcgctggcaggctccccgcaccaacttatgg
gggcagcgctatacagataatactgaaaaccttgatccagggctggcgtttgccgggcag
taccgtgacgcggaaagtagcttatgctataacaggttccgctattatgatccgaatggt
ggttattatatctcgcctgaccctgtgagtattttcgggggagatgttaattacggatat
gcacataacccgcttggttgggtggatccgtttgggcttgcttcctgtgaacacttaaac
agaatggcaaaggaagttcatgatcttgctggaggtctaaaaaccccagacacccgggcc
attagaaactcaacagtttcaattgttgaggctactgtagacggtaaaaaagttttatat
gcagctggtagtggtggccgtcttaatccaaggcaagtggaaactctagagaggttaggt
gtatctagggaaaatattttcaaaggggctcgagtaacaaatgaattttcaaaactggag
aatcatgctgaaagaataatattaagaaatcttcctgaaggcgctgttgttaataggtgg
ggaatatcgtggggtggtttgcaaagaggaataccttgcgaccattgtgctccatttgtg
cgagatgctggtggttttttttag

DBGET integrated database retrieval system