KEGG   Pectobacterium parmentieri WPP163: Pecwa_1622
Entry
Pecwa_1622        CDS       T01106                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3
Other DBs
NCBI-ProteinID: ACX87412
Position
complement(1762450..1762884)
AA seq 144 aa
MLALASTSSFWWHTLAIVMLTALLSPLAQAADVIVVTDTRHPVQNRGNTRLIELDGPSRI
EAELAANLPQDPARAAIIVQQRLREGGTALQQRINEAYQDVVDAWSLGITTLPAVIVDQR
YVVYGEPDVAKAVARINTYRRTQP
NT seq 435 nt   +upstreamnt  +downstreamnt
atgctggctctcgcttcaacctcttcattctggtggcatacgcttgccatcgtcatgctg
actgccctgttgagcccgctggcgcaggccgcagatgtaattgtcgtcaccgacacacga
cacccagttcagaaccggggtaatacccggctcatcgaactggacggcccctcacgcatt
gaggcagaactagcagccaaccttccccaagacccggcacgcgccgccatcatcgtgcaa
caacgcctgagagaaggcggcacagcgctgcagcaacgcatcaacgaggcctatcaggat
gttgtcgatgcctggagcctgggcattaccacccttccggccgtcatcgtcgatcaacgc
tatgtggtttatggtgaacctgacgtcgccaaagcagtggcgcgtatcaacacatacagg
aggactcagccatga

DBGET integrated database retrieval system