KEGG   Pectobacterium parmentieri WPP163: Pecwa_1626Help
Entry
Pecwa_1626        CDS       T01106                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV TrwB_AAD_bind AAA_10 AAA_22 FtsK_SpoIIIE T2SSE AAA_16 ATPase_2 AAA_7 DUF87 AIG1 Pox_A32
Motif
Other DBs
NCBI-ProteinID: ACX87416
Position
complement(1765585..1768434)
Genome map
AA seq 949 aa AA seqDB search
MVWSLPWRKPTVPTKGEQPDGWQRHIDTLQQAGIPEPGTSVRGSRPATQADEQALYEVAP
SFVALLPWVEYLPESQSMLLEDGVSVAAFFELTPLGTEGREPVWLAQARDALENALQDSF
DELDDNPWVLQLYAQDETNFDQYLQTLKGYIQPRAQHSRFTEFYLHSMAHHLRAVAKPGG
LFEDTTVTRLPWRGQTRRVRMIVYRRTAGSTTRRGQTPEQALSVVCDRLSGGLANAGIRA
QRLDASHIHNWLLRWFNPHPTLLGHSAEDCERFYQLTAYPDTHDLDEIELASGCDFSQRL
FFGQPRSDTARGEWHFDGMPHRVMTTDRLRAPPSVGHMTGENRKGDAINTLFDQMPEDTM
MCLTLVATPQDVLETHLNHLAKKAVGETLASEQTLADVQEARSLIGSAHKLYRASLAFYL
RGKDEEELDSRGLQLANVMLGAGLQPVREEDEVAPLNTYLRWLPCMYNPAQDRKQWYTQM
MFAQHVANLSPTWGRSRGTGHPGITVFNRGGGLITFDPFNRLDRQMNAHLFLFGPTGSGK
SATLNNLLNQVTAIYRPRIFIVEAGNSFGLFCEFARRLGLTVNRVKLAPGAGVSLAPFAD
ARRLIETPSDVQTLDADELDDEPQSKEAEADEQRDVLGELEITARLMITGGEDKEEARMT
RADRSLIRQCILDAAQRCVAANRTVLTRDVRDALRERGHDTTLPEIRRARLLEMADAMDM
FCQGSDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLINTVNNIAERDQFL
GRPILNVTDEGHIITKNPLLSPYVVKVTKMWRKLGAWFWLATQNIDDLPKAAEPMLNMIE
WWICLSMPPDEVEKIAKFRELTPAQKALMLSARKESGKFTEGVILSKSLEVLFRAVPPSL
YLALAQTEPEEKAERYQLMQQLGIGELDAAFKVAEMIDHARGITPMAQR
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggtctggtcgcttccctggcgcaagcccactgtgccgaccaaaggcgaacagccggac
ggctggcagcgccacatcgatacactacagcaggcaggcattcccgaacccggtaccagc
gtaagggggagccgtcccgctacccaggccgatgagcaggccttgtacgaggtggcccca
tcgtttgtcgcgttgctgccctgggttgaatatttgcccgaatcacaaagtatgctgctg
gaggatggtgtctcagtcgccgccttctttgaactgaccccgctgggtacagaaggccgt
gagccggtctggctggcccaggcacgggatgcgctggaaaacgcgctgcaggacagcttc
gacgagctcgacgacaatccctgggtactgcaactctacgctcaggacgagaccaacttt
gatcagtatctgcagaccctcaagggctacatccagccacgtgcgcagcactcacgcttc
accgaattctatctgcattcgatggcccatcacctgcgcgcagtagcaaagccgggaggc
ctgttcgaggatacgacagtcacgcgtctgccctggcgagggcaaacacgacgggtacgc
atgatcgtctatcgccgcaccgcaggcagcacgacccgacgcggccagacgcccgagcag
gcattgagtgtggtctgtgatcgcctgagcggtggtctggccaacgcaggcatccgcgca
cagcgtctggatgcatcgcacatccacaactggctgctgcgctggttcaacccacatccc
acgctgctgggccacagcgccgaagactgcgaacgtttctaccagttgaccgcctacccg
gacacccacgacctcgacgaaatcgagctggcctccgggtgcgatttcagccagaggctg
ttcttcggccagccacgttcagatacggcccggggcgagtggcactttgacggcatgccg
catcgggtgatgacgaccgaccgcctgcgcgcaccgcccagtgtaggtcatatgacaggc
gagaatcgcaaaggcgacgccatcaacaccttgttcgaccagatgccggaagacacgatg
atgtgcctgacactggttgccacaccacaggacgtactcgaaacacacctgaatcatctg
gcaaagaaagccgttggcgaaacgctggcctccgaacaaaccctggcggatgtgcaagag
gcgcgctcactgatcggcagcgcccacaaactataccgtgccagcctggccttttacctt
cgtggcaaggatgaagaagaactcgacagccggggactgcaactggccaacgtgatgctg
ggcgcaggcctgcagccggtacgcgaagaggacgaggtcgcgccgctcaacacctacctg
cgctggctgccgtgtatgtacaacccggcccaggaccgcaaacagtggtacacacaaatg
atgttcgcccagcatgtggccaacctctcaccgacctggggacgtagccggggtacaggt
cacccggggatcactgtcttcaatcgcggtggaggcctgatcacgtttgatcccttcaac
cgcctggatcggcagatgaacgcgcaccttttcctgttcggccctacaggttcgggcaag
agcgccaccctcaacaacctgctcaatcaggtcaccgccatctatcgtccacggatcttc
attgtggaggctggcaattccttcgggctgttctgcgagttcgcccggcgtttagggctg
actgtcaaccgtgtcaagctcgctccgggtgcgggcgtcagtctcgcaccgttcgccgat
gcccgcagactcatcgaaacccccagtgatgtacaaacactcgatgccgatgaactcgat
gacgagccacagagcaaggaagccgaggccgacgaacaacgcgatgtgctgggcgaactg
gagatcacggcacgcctgatgatcacggggggtgaagacaaggaagaagcccgcatgacc
cgcgccgatcgctcgttgatccgccaatgcattctggacgccgctcagcgctgcgtcgct
gcgaaccgtaccgtgctgacccgtgacgtgcgcgatgcactacgtgaacggggtcatgac
acgacgctgccggaaatccggcgcgctcgcctgctggagatggccgacgcgatggatatg
ttctgccagggcagcgatggtgaaatgttcgaccgtgacggaacgccctggcccgaggcc
gacatcaccctggtcgacctggcaacctatgcacgcgaaggctacaacgcacaactgtcg
atcgcctacatctcgcttatcaacaccgtcaacaacatcgccgagcgcgaccagttcctg
ggccgccccatcctcaacgtgacggacgaaggccatatcatcaccaaaaaccccttgctc
tcgccctacgtcgtgaaggtcacgaaaatgtggcgcaagctgggtgcgtggttttggctc
gcgacacagaacatcgacgacctgccgaaggccgcagaacccatgctcaacatgatcgaa
tggtggatttgcctgtcgatgccacccgacgaggtggaaaaaatcgcaaagttcagggaa
ctgacacccgcgcagaaagcgctgatgctgtccgcacgcaaagaatccggaaaattcacc
gaaggcgtcatcctctccaagagcctggaagtgctcttccgtgccgtaccgcccagcctc
tatctcgccttggcgcagaccgaacccgaggaaaaagccgaacgctaccaactgatgcag
cagctcgggattggggagttggatgcggcgttcaaagtggccgaaatgattgatcatgca
cgtggtatcacgcccatggcgcaaaggtaa

DBGET integrated database retrieval system