KEGG   Pectobacterium parmentieri WPP163: Pecwa_1629Help
Entry
Pecwa_1629        CDS       T01106                                 

Definition
(GenBank) putative secreted protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: ACX87419
Position
complement(1770248..1771150)
Genome map
AA seq 300 aa AA seqDB search
MKHRRLCLIWLGLMALVQTPALHAVEILRWERLPLAVPLSVGQERIVFVDRNVRVGVPAS
IGDRLRVQSAGGAIYLRASEPIEPTRLQLQDADSGALILLDIAATPAKDGEPALEPIRIV
EGNATPPRYGQPPDNAPPAPTADQARPAQRETPVAVVLTRYAAQSLYAPLRTLEPVPGIM
RISLRRDLPLDTLLPTLPVEAKALASWRLEDQWVTVVRLTHTGNGWIELDPRALQGDFLT
ATFQHTALGPRGSPEDTTVLYLVTRKHGLPQSLLPAIQRFDPAMHLPATTPPTTEVHHAQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgtcgtctctgtctcatctggctggggctgatggccttggtgcagactcct
gcgctccatgccgtggaaatcctgcgctgggagcggctgccacttgccgtgccactttct
gttgggcaggaacgcattgtgttcgtagatcgcaacgtccgtgtcggcgtcccggccagc
atcggcgaccgtctgcgtgtacagagcgcaggtggagccatctacctgcgtgccagcgag
cctatcgaacccactcgattgcagttgcaggacgccgacagcggtgcgctgatcctgctc
gacatcgcggccacaccagccaaagacggcgagcctgcacttgagccgatacgcatcgtt
gagggtaatgccaccccaccccgctatggtcagccgccagacaacgccccccccgccccc
acggcagaccaggccagaccggcgcaacgtgaaacaccagtggccgtggtactcacacgt
tacgccgcacaaagcctgtacgcgccattacgcaccctagagcctgtgcccggcataatg
cgcatcagcctgcgccgcgacctgccactggatacgctgctaccgacactgcctgtagag
gcaaaagcgctggcctcatggcgattggaagatcagtgggtcactgtcgtgcgactgaca
catacaggcaatggctggattgaactcgatccacgcgcactacaaggtgatttcctcacc
gccactttccagcatacggcgctcggcccacgcggctctcccgaagacaccacggtactg
tatctggttacccgcaagcacggactgccgcagtcgctactgcccgccatccaacgcttt
gatcctgccatgcacttgcctgccaccacgcccccgacaacggaggtacatcatgcgcag
taa

DBGET integrated database retrieval system