KEGG   Pectobacterium parmentieri WPP163: Pecwa_1634Help
Entry
Pecwa_1634        CDS       T01106                                 

Definition
(GenBank) Protein of unknown function, RAQPRD
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD
Motif
Other DBs
NCBI-ProteinID: ACX87424
Position
complement(1772842..1773222)
Genome map
AA seq 126 aa AA seqDB search
MVLPAQLRAVRRSAPIFLSAALMLGSSFSVYADTPAQSQDLAAALRQLDALERLVVQSAS
RTPAEPGERYYFDYPRLRDDIARIRIGIQAHLTPSRAQPRDLAELNGNYRQESTEKHGDT
FLKNQP
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggttctcccagcccagcttcgcgctgtacgccgcagcgcgcccatctttctctccgca
gccctcatgctcggcagttcgttctctgtctatgccgacacaccggcgcagagccaggat
cttgctgctgcgctaaggcaactcgacgcattggaacgcctcgtcgtgcagagcgcatcc
agaacccccgcagagccaggcgaacgctattacttcgactacccaaggctacgcgatgac
attgctcgcatacgcatcggtatccaggctcatctcacgccatcccgcgcccagccacgc
gaccttgccgaactgaacggtaactaccgtcaagaatcgacagaaaaacacggcgacacc
ttcctgaagaaccagccatga

DBGET integrated database retrieval system