KEGG   Pectobacterium parmentieri WPP163: Pecwa_1638
Entry
Pecwa_1638        CDS       T01106                                 
Name
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87
Other DBs
NCBI-ProteinID: ACX87428
Position
complement(1775293..1777452)
AA seq 719 aa
MAQSQPVEVLLRPPVELYTVAVCAGAALLCLTAPWSLALSPDIGIGSALAFGIFGTLRWR
DAQVILRYRRNIRRLPRYVMTSRDVPVSQQRLFIGKGFRWEQKHTHRLMQTYRPEFRRYV
EPTSAYQLARRLEERLEFAPFPLSQLPRLTTWDIPLNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKNHLSEHEVVIVFDPKGDADLLKR
MFVEARRAGRENAFYVFHLGWPEISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAQHYFVRTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLSDPRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
MVSVAGHIYKFGIDDGLPGASADTKVPINVHADEFNELMGDEFIPMINKGGGAGIQVTAY
TQTLSDIEARIGNRAKAGQVVGNFNNLFMLRVRETATAELLTKQLPKVEVYTTTVVSGAT
DSSDIHAKTDFTSNTQDRISMSSVPMIEPSHVVQLPKGQCFALLQGGNLWKVRMPLPAPD
PDEIMPADLQQLAGYMRQSYTDTGQWWQNQGSPTLQEQALPPELLDEDADPIIDESKAP
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcacagtctcagccggtcgaggtactgctgcgtcccccagtagaactctataccgtt
gcggtttgcgccggggccgcattgctgtgcctgacggctccatggtctctcgcgctgagt
ccggacataggcatcggcagcgcactggccttcggaatttttggcacactgcgctggcgc
gatgcacaggtgatcctgcgctaccgacgcaatatccgtcgcctgccgcgttacgtgatg
accagccgcgacgtgccagtcagccaacaacgcttgttcattggcaaagggtttcgttgg
gagcaaaaacacactcaccggttgatgcaaacctatcggcctgagttcaggcgttatgta
gagccgacatccgcctaccagttggcccgacgtctggaggagcggctggagtttgcacca
tttccattatcgcaactgccccgtcttacgacctgggatataccgctcaatccggtgcgg
ccattaccgcccgttggcggcttaccgcgtctgcatggtattgagcctgacgaggtggac
gtcagcctgcccttgggtgagcgtgttggtcactccctggtactgggcaccacacgcgta
ggcaaaacgcggctggctgaattattcatcacccaggatattcgtcgaaaaaatcacctg
agcgagcacgaagtggtcattgttttcgaccctaaaggcgacgcggatctgctcaagaga
atgttcgtcgaggccagacgtgcaggaagagagaatgcgttctacgtgtttcatctgggg
tggccggagatcagcgctcgttacaacgcggtgggacgttttggccgcatcagtgaagtc
gcgacccgcatcgcagggcagctttccggagagggtaactctgctgcattcagagaattt
gcctggagattcgtcaatgtgattgcacgtgcattgatcgagctggggcaacgacctgac
tacctgctgatccagcgccatgtcatcaatatcgatgcgttgttcatcgagtacgcccaa
cactacttcgtccgcacagaaccgaaagcctgggaggtcatcgtccagattgaagccaag
ctcaacgagaagaacattcccaggaacatgatcggtcgcgaaaagcgcgtggttgccctt
gagcaatacctcagccaggcccgtaactacgatcccgtactggacggactgagatcagcg
gttcgctacgacaaaacgtactttgacaagatcgtcgccagcctgctgcctctgcttgaa
aaactcaccagcggcaaaatcgcccaattgctggcaccgaactactcggatctgagtgac
cccaggccgattttcgactggatgcagatcatcaggaaacgcgcggtcgtctacgtcgga
ctcgatgcgctctccgatgccgaagtcgccgctgcggtgggcaactcgatgttcagcgat
atggtctcggtggccggacacatctataaattcggcatcgacgatggcctgcccggtgca
tcggctgacaccaaagtaccaatcaatgttcatgccgatgaattcaatgaactgatggga
gacgaattcatcccgatgatcaacaaaggcggcggtgctggcatccaggtcaccgcttat
acccaaaccctcagtgatattgaagcccgcatcggcaatcgcgccaaagccggtcaagtc
gtcggcaatttcaacaacctgttcatgctgcgcgtgcgcgagacagccaccgccgaactg
ctcacaaaacagttgcccaaggtggaggtctacacgacgaccgtggtcagcggcgcgaca
gacagctccgacatccacgccaaaaccgacttcaccagcaacacacaggatcgcatcagc
atgtcgagcgtgccgatgattgagccgtcacacgtcgttcaacttccgaaagggcaatgc
tttgcactgctacagggtggcaacctgtggaaagtccgcatgcccctgcccgcccccgat
ccagatgaaatcatgccggccgatcttcagcaattggctggctacatgcgccaaagctac
accgatacaggtcaatggtggcagaaccagggctcgcctacgctacaggagcaagcgcta
ccgcctgaactgcttgatgaggatgccgaccctattatcgacgagagtaaagcgccatga

DBGET integrated database retrieval system