KEGG   Pectobacterium parmentieri WPP163: Pecwa_1639
Entry
Pecwa_1639        CDS       T01106                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF2859 HpcH_HpaI
Other DBs
NCBI-ProteinID: ACX87429
Position
complement(1777457..1777996)
AA seq 179 aa
MTTHIKTAYSLFLTLTTVSPLIHAAQPPIVVEDHGGASALPYYEALNLQVRSPDTPRPPI
AMPPIQVNPATEADMLPVRSPKLSSGTVARRVIDAPGLQPFFLVGDDEASHAWLQRQSVL
LHERGAIGLVVNVETEDGLARLRAIAPGLQFAPVAADDLTERLGLRHYPALITSTGIEQ
NT seq 540 nt   +upstreamnt  +downstreamnt
atgacaacccacatcaagacggcatacagcctgttcctgacactgacaacagtatcgcca
ttgattcatgcagcacagccgccgatcgtggtggaagaccacggcggagcctctgctctg
ccgtactacgaggcgctcaaccttcaggtacgctcacccgataccccacgccctcccatt
gccatgccgccgatacaggtaaacccagcaaccgaagcagacatgctgccagtacgcagc
ccgaagctctcctctggcaccgtagcacgccgggtcatcgatgcaccgggcctgcaaccg
ttctttctggtcggcgacgatgaggcatcccatgcgtggctgcagcgccaaagcgtatta
cttcacgaacgaggtgccatcggcctggtggtcaacgtcgagaccgaagacggcctggca
cgcctgcgtgctatcgcaccaggtctgcagtttgcgccagtggcggccgatgacctgact
gagcgacttggcctgcggcattaccccgcgctcatcaccagcacgggcattgagcaataa

DBGET integrated database retrieval system