KEGG   Pectobacterium parmentieri WPP163: Pecwa_1643Help
Entry
Pecwa_1643        CDS       T01106                                 

Definition
(GenBank) putative secreted protein
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACX87433
Position
complement(1779955..1780524)
Genome map
AA seq 189 aa AA seqDB search
MSPTHSTQRLFVSHLLIIAALSSGCTTTTAPPHSPPIKAVASVPDATPDFIPVLRYGRYT
LIELAPDAAQRDLLLQVIDVSIPEHSRATVGDGLRHALKRSGYQLCETAQSVIELYSLPL
PAAHLHLGPMTLRETLLTLAGPYWALYVDNRTRQVCFKRPDIDAGAGTANGDTQVADAVK
PLPPAGGQP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccacacattcaacccagcggctgtttgtcagtcacctgctgatcattgcagcc
ttgagcagcggatgtacaacaaccactgccccgccccactctccgcccatcaaagcggtc
gcctcggttcccgacgctacgccggatttcattcccgttctacgttacggacgctatacc
ctgatcgaactggctcccgatgcggcgcagcgtgatctgttgctgcaggtgatcgacgta
tcaatacccgagcattcccgcgctaccgtgggtgatggcttgcggcacgccctcaagcga
agtggctaccagctttgcgaaacggcccagtctgttattgaactctattcactgccactg
cccgctgctcatctacacctcggcccgatgaccttgcgggagacattacttaccttagcc
gggccgtactgggcgctgtacgtcgataaccgtacacgacaagtgtgcttcaaacgcccc
gatatcgacgctggcgctggcacagcaaatggcgacactcaggtcgccgatgcagttaag
cccctccctcctgccggagggcaaccatga

DBGET integrated database retrieval system