KEGG   Pectobacterium parmentieri WPP163: Pecwa_2116Help
Entry
Pecwa_2116        CDS       T01106                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00030  Pentose phosphate pathway
pwa00480  Glutathione metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pwa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
pwa_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pecwa_2116
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pecwa_2116
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pwa04147]
    Pecwa_2116
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Pecwa_2116
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Pecwa_2116
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Pecwa_2116
  Exosomal proteins of colorectal cancer cells
   Pecwa_2116
  Exosomal proteins of bladder cancer cells
   Pecwa_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACX87891
Position
2307344..2308819
Genome map
AA seq 491 aa AA seqDB search
MAVTSTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHADTKIIGVGRADWDKAEYTR
VVREALDTFMKEAIDDKLWETLSGRLDFCNLDVEDTKAFNKLGKMLDQKNRTTINYFAMP
PSTFGAICKGLGTAGLNKDPARVVMEKPLGTDLASSRVINDQVAEFFNECQVYRIDHYLG
KETVLNLLALRFANSLFSSNWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILTMIAMSPPSDLTTDRIRDEKVKVLRSLRRIDRSNVHETTVRGQYSSGFVQGHKVPG
YLEEEGANKSSSTETFVSIRVDIDDWRWSGVPFYLRTGKRLPTKCSEVVVYFKNPALNLF
HDSYQQLPQNKLIIRLQPDEGVEIQILNKIPGLEHKHRLQTVKLDLSFSETFNQQHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSIMEAWAMDNDAPKPYQAGSWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacttcaacagcccaagcgtgcgatctggttattttcggtgccaagggcgat
ctggcacgccgtaaattgctgccgtccctgtaccagttggaaaaagcagggcacatccat
gcggacaccaagattatcggggtgggccgtgcggattgggataaagcggagtatacccgc
gtcgtgcgcgaagcgcttgacacctttatgaaagaagccatcgacgataagttgtgggaa
acgctaagcggtcggttggatttctgcaatctcgatgtggaagacacaaaagccttcaac
aaactgggcaagatgcttgatcagaaaaatcgtaccaccatcaactactttgcaatgccg
cccagcacatttggtgcgatctgcaaagggctgggaaccgctgggctgaataaagatccg
gcgcgtgtggtgatggaaaaaccgttgggtaccgatctggcatcgtcgcgtgtgattaac
gatcaggtcgcggaattctttaacgaatgtcaggtttaccgcatcgaccactatctgggt
aaagagacggttctgaacctgttggcgctgcgttttgccaattcgttgttctcctcgaat
tgggacaaccggacgatcgaccatgtacagatcacggtagctgaagaagtcggaattgaa
ggtcgctggggctattttgacaaagccggtcagatgcgcgacatgatccaaaatcatctg
ttgcagatcctgacgatgattgcgatgtcaccgccgtctgatttgacgactgaccgcatc
cgtgatgaaaaagtgaaagtgttgcgttcactgcgtcgtatcgatcggtccaacgtgcat
gaaacgaccgtgcgcggccaatattcttctggttttgttcagggccataaagtgccgggc
tatctggaagaagaaggcgcgaataaaagtagcagcacggaaaccttcgtctcgattcgt
gtcgacattgatgactggcgctggtctggcgtgccgttctacctgcgcacgggtaaacga
ctgccgacaaaatgttcggaagtggtcgtgtactttaaaaatcctgcgttgaatctgttc
catgattcttaccagcagttaccgcagaacaaactgatcattcgcttgcagccggatgaa
ggcgttgaaattcagattctgaataaaattccaggattagagcacaagcatcgattgcaa
acggtgaaactggatctgagcttctcggaaacctttaatcagcagcatttggcggatgcc
tatgagcgtctgctgcttgaaaccatgcgtggaattcaggcgttgttcgtccgccgtgat
gaagttgaggaagcctggaagtgggttgattcgatcatggaagcgtgggcgatggacaac
gatgcgccgaagccttatcaggcgggaagctgggggcctgtggcgtccgtggcgatgatc
acgcgtgatggccgttcctggaatgagttcgagtaa

DBGET integrated database retrieval system