KEGG   Pectobacterium parmentieri WPP163: Pecwa_2461
Entry
Pecwa_2461        CDS       T01106                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
pwa  Pectobacterium parmentieri WPP163
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pwa02044]
    Pecwa_2461
Secretion system [BR:pwa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pecwa_2461
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACX88222
Position
complement(2665918..2666448)
AA seq 176 aa
MASTKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLVGKPLEPQVALDE
RKFLEIDIDNFDERMKALKPRAAFQVDNTLNGEGKLNIDLTFESMDDFSPDAIARNVEPL
SKLLDARTQLANLLTYMDGKNGAEELVGKILQDPTLLQALTHLPKQDDAAEGKEDQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcatcaacgaaatccagtgggcaaaagttcattgcccgcaatcgcgcacctcgcgtt
cagatcgaatatgacgtggaaatttatggcgcggaacgcaaaattcagttgccgttcgtc
atgggggtattggcggatctggtgggcaaaccgctggagccgcaggtggccctcgatgaa
cgtaaattcctcgaaatcgacatcgataactttgatgagcgcatgaaagcgttgaagccg
cgcgctgcctttcaggtggataacacgttgaacggcgaaggtaaattgaacatcgacctg
actttcgaaagcatggacgacttctcgcctgacgccatcgcgcgcaacgttgagccgctg
agcaagctgttggatgcacgtacccagttggctaacctactgacctatatggacggtaaa
aacggtgcggaagaactggtcggtaaaattttgcaagaccccacgctgctgcaggcgttg
acgcatctgccgaagcaggacgatgccgctgaaggtaaggaagatcaataa

DBGET integrated database retrieval system