KEGG   Pectobacterium parmentieri WPP163: Pecwa_3033Help
Entry
Pecwa_3033        CDS       T01106                                 

Definition
(GenBank) Undecaprenyl-phosphate galactose phosphotransferase, WbaP
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
pwa  Pectobacterium parmentieri WPP163
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pwa01005]
    Pecwa_3033
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     Pecwa_3033
Lipopolysaccharide biosynthesis proteins [BR:pwa01005]
 O-antigen
  Pecwa_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ACX88778
Position
complement(3301371..3302807)
Genome map
AA seq 478 aa AA seqDB search
MSAKIIFRKNNTIKVFLALSDFVFFNFTLLLTLGLMRVLGYDIYFFIPKSEISARFLSHI
TLSFLCVGWFWIRLRHYTYRKPFWFELKEVIRTLVIFSVFDLALVAFSKWQFSRYVWCIT
WSLAIVLVPVGRVIVKRVLDKFHIWKRHTIIIGTGKNAKDAYAALQSEEVLGFSIDAFYS
INNVESVAYIFDVPVINTEEELWLQSCPEDTQFIVALEFEDHVLRDFWLKNLAKHNCRSV
SVIPTLRGVPLYGTDMSFIFSHEVMILRVNNNLAKRTSRFIKRIFDLFGALAIVSVLSPI
LISLFYLVAKDGGNAIYGHERIGRNGKKFKCLKFRSMVINSQEVLSELLEKDPGARIEWA
TDFKLKNDPRITKVGQFIRKTSLDELPQLFNVLKGEMSLVGPRPIIEDELDKYAGDVDYY
LMAKPGMTGLWQVSGRNDVDYDTRVYFDAWYVKNWSLWNDIAILFKTIGVVLKRDGAY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaaaattatttttagaaaaaacaatactattaaagtttttttagccttgtca
gattttgttttttttaatttcacgctgcttcttacattaggattaatgcgtgttcttggg
tacgatatatatttttttatccctaagtctgagatctcagcaaggtttttatcacatatt
acattgtcatttctatgtgttggttggttttggatacgattgcgacactatacttataga
aaacctttttggtttgaattaaaagaggttatcagaacgttagttatattttcagttttt
gatttagccttggtcgcattttcaaaatggcagttctcgcgatatgtttggtgtattact
tggtcgctggcaattgttttggtgccagttggccgagtgatagtaaaaagagttctagat
aaatttcatatttggaagagacacacgattattattggcacaggaaaaaatgccaaagac
gcatatgcggctctccaaagtgaagaggttttagggttttctatcgatgctttttattct
attaataatgttgagagtgttgcttatatttttgacgtgccagttattaatactgaagag
gaactttggttgcaaagttgtcctgaggacacgcaatttattgttgccttagagtttgaa
gatcatgtcttgagagatttttggttgaaaaatttggctaaacataactgtcgctcggtt
tccgttattccaactcttcgcggtgttcctttatatgggacggatatgtcatttatattt
agccatgaagtcatgattcttcgtgtaaacaataatttagcaaaaagaacttcacgcttt
attaaaagaatttttgaccttttcggggctttagcgattgtttccgtactttctcctatc
ctaatatccctattctatttagtcgccaaagatggtggtaatgcaatttatggacatgaa
cgtatagggagaaatgggaaaaaatttaagtgcctcaagttccgttctatggtaataaat
tcccaagaggtgctcagtgagttgttggaaaaagatccgggggcaagaattgaatgggca
acggattttaaacttaaaaatgatcctagaataacaaaagttggtcaatttataaggaaa
accagcctggatgagctaccgcaactttttaatgttcttaaaggagaaatgagtttggtt
ggcccaagaccaattatcgaagatgagttggataaatatgcaggagatgtagactattat
ctaatggctaaaccggggatgacagggctatggcaggttagtggtagaaacgatgtggat
tatgacacacgagtttatttcgacgcatggtatgttaaaaattggtcattatggaatgat
atagctatcctttttaagacgattggtgtcgtgttaaaaagggacggagcttattaa

DBGET integrated database retrieval system