KEGG   Pectobacterium parmentieri WPP163: Pecwa_3099Help
Entry
Pecwa_3099        CDS       T01106                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00020  Citrate cycle (TCA cycle)
pwa00310  Lysine degradation
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pecwa_3099
  Amino acid metabolism
   00310 Lysine degradation
    Pecwa_3099
Enzymes [BR:pwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pecwa_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACX88841
UniProt: D0KIP6
Position
complement(3376844..3378070)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGVLDAV
LEEEGATVTSRQLLGRIRRGDSSGKETGEKSQSKESTPAQRHTAGLEEENSDALSPAIRR
LIAEHDLDASTIKGSGVGGRITREDVDKHLAAQKKDSGKAAKSEAPAASPAPVLGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALGMADIEK
RIKELAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtacccgacctgcctgaatctgtagctgacgccactgtt
gcaacctggcataaaaaaccaggcgatagcgtccagcgtgatgaagtattggttgagatt
gaaactgacaaagtggtgctggaagtgccagcctctgaagcaggcgttctggatgccgtg
ctggaagaagaaggcgcgacggtaacgtctcgccaactgctaggccgtattcgccgtggt
gatagttccggtaaagaaactggcgagaaatcgcagagtaaagaatcgacgccggcacag
cgtcataccgctggtctggaagaagagaacagcgatgcgcttagcccggctatccgccgc
ctgattgcagagcacgatctcgatgcgtcaacgattaaaggcagcggcgtgggtggtcga
attacccgtgaagacgtggataagcatttggctgctcagaagaaagactctggtaaagcg
gctaaatctgaggctccggcagcttctcctgcgcctgttctgggggcgcgtagcgaaaaa
cgcgtaccgatgacgcgcctgcgtaagcgtgttgctgagcgtctgctggaagcgaaaaac
agcaccgcaatgttgacgacgtttaacgaaatcaacatgcagccgatcatggatctgcgc
aagcaatacggtgaagcgtttgagaagcgtcacggtgtacgtctgggcttcatgtccttc
tacatcaaagccgtcgttgaagcgctgaaacgttaccctgaagtaaatgcctccattgat
ggcgaagatgtggtttaccacaactatttcgatgtcagcattgcggtttctaccccgcgt
ggtctggtcacgccagtactgcgtgatgtcgatgcgctgggcatggccgacattgagaag
cgtatcaaagagctggccgtgaaaggccgtgacggtaaactgacggttgaagaactgctg
ggtggtaacttcacgattaccaatggcggtgtctttggttctctgatgtctaccccaatc
atcaacccaccgcagagtgcgatcctgggcatgcatgccattaaagatcgcccaatggca
gttgatggtcaggtggttattttgccgatgatgtatctggcgctgtcttacgatcaccgc
ttggtcgatggccgtgagtccgttggcttcctcgtgacggtgaaagaaatgctggaagat
cccgcgcgtctgctgctagacgtttaa

DBGET integrated database retrieval system