KEGG   Pectobacterium parmentieri WPP163: Pecwa_3171Help
Entry
Pecwa_3171        CDS       T01106                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00071  Fatty acid degradation
pwa00280  Valine, leucine and isoleucine degradation
pwa00310  Lysine degradation
pwa00362  Benzoate degradation
pwa00380  Tryptophan metabolism
pwa00620  Pyruvate metabolism
pwa00630  Glyoxylate and dicarboxylate metabolism
pwa00640  Propanoate metabolism
pwa00650  Butanoate metabolism
pwa00900  Terpenoid backbone biosynthesis
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
pwa01212  Fatty acid metabolism
pwa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pecwa_3171
   00630 Glyoxylate and dicarboxylate metabolism
    Pecwa_3171
   00640 Propanoate metabolism
    Pecwa_3171
   00650 Butanoate metabolism
    Pecwa_3171
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pecwa_3171
   00072 Synthesis and degradation of ketone bodies
    Pecwa_3171
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pecwa_3171
   00310 Lysine degradation
    Pecwa_3171
   00380 Tryptophan metabolism
    Pecwa_3171
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pecwa_3171
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pecwa_3171
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pecwa_3171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pwa04147]
    Pecwa_3171
Enzymes [BR:pwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pecwa_3171
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pecwa_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACX88913
UniProt: D0KIW8
Position
3453439..3454617
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASQAAGLSFEIPSLTVSKVCGSGLKAVVLGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDRVAL
ASQQKAVAAIEAGRFKVEITPLSLRSKKETRIFDRDEFPRADTTLASLTALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
IKAGLTIGDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcaattggtaaatttgcaggc
agtctggccaacacctctgccatcgagatggcctctgccaccatccgcgactgcctgtcg
acgctgccggacacgctggcgatcgatgaagtgattctcggcaacgtgctgcaagccggt
ctgggacaaaaccccgcgcatcaggccagccaagctgccggtctgtcttttgaaattcct
tcgctgaccgtcagcaaagtatgcggttccggcctgaaagccgttgtgctgggtgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaagatggtctgtggtgtgcgtttaacgattaccacatgggcaccaca
gcggaaaatatcgccgagcgctatcagctcacgcgagaagaacaggatcgggtggcgctg
gcgtcgcagcagaaagcggtcgccgcgattgaagcgggtcgcttcaaagtcgaaattacc
ccactgtcgctgcgtagcaaaaaagagacacggattttcgatcgggacgaattccctcgc
gcagacaccacgctggcgtcgttgacagcgttacgtccggcattctccgcgaatggcacc
gtcaccgctggcaacgcatccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcgtatccgtagctgggcttcg
gctggcgtaccgagtgaagtcatggggctggggccaattccggcgacgcagaaagcgctg
atcaaggctgggttgacgatcggcgatattgacctgatcgaagccaatgaagcctttgcc
gcgcagtttctagccgtacagcgcgatctccaactagacccagaaaaggtgaatgttaac
ggcggtgcgattgcattgggtcaccctatcggcgcgagcggtgcccgtattctcgttacg
ctggtacatgcgctgcacagctataacaaaacgctggggttggcgacgctgtgcatcggc
ggcgggcaaggtatcgccatgatcgtcgagcgcgtttaa

DBGET integrated database retrieval system